Protein Info for ABZR86_RS13910 in Dyella japonica UNC79MFTsu3.2

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 677 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 36 to 55 (20 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 163 to 180 (18 residues), see Phobius details amino acids 189 to 206 (18 residues), see Phobius details amino acids 209 to 225 (17 residues), see Phobius details amino acids 234 to 253 (20 residues), see Phobius details amino acids 264 to 282 (19 residues), see Phobius details amino acids 302 to 324 (23 residues), see Phobius details amino acids 335 to 353 (19 residues), see Phobius details amino acids 365 to 383 (19 residues), see Phobius details PF04932: Wzy_C" amino acids 194 to 318 (125 residues), 64.1 bits, see alignment E=3.3e-21 PF13641: Glyco_tranf_2_3" amino acids 398 to 614 (217 residues), 64.6 bits, see alignment E=3.2e-21 PF00535: Glycos_transf_2" amino acids 402 to 517 (116 residues), 68.4 bits, see alignment E=1.8e-22 PF02709: Glyco_transf_7C" amino acids 572 to 619 (48 residues), 41.4 bits, see alignment 2.4e-14

Best Hits

Predicted SEED Role

"Putative two-domain glycosyltransferase" in subsystem LOS core oligosaccharide biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2EFT7 at UniProt or InterPro

Protein Sequence (677 amino acids)

>ABZR86_RS13910 glycosyltransferase (Dyella japonica UNC79MFTsu3.2)
MPTWFRYWMLLGMWWLLVGLAGSPTGSKVWNPGKPYHDSLIVLFLLPALWLAWKWRGVMF
RGLARVPEGPLLAAFFGWAIVTVGWARNGNLGDDVVVVLYAALFVAIWASLVAGQPRRFH
QVLYWAGVGLSLAALVGMAAFPLRDGVWQAQDRLMAFGTLNNPNLAAFAFGAAISWMTQL
SVRDKRLRVLQWISIVALLGFVLLTLSRSAWLALIVSQGVIMLGATRRHLRRRAAVMLVV
AAVIIALGGWQYMEERGMSYRPQILAQAMGLFLQHPILGLGMGSRYTIHVGDQEWEHSHN
VFSHLAIVLGLPGLLLWVALWLVVGWRAWRYRHVALGRALLAMWVYASVAWQFDAPQMLR
RPDVEWLLGWLPLAMSIGLAWRIRDDGAPAAATDGRKPAKVSLVVLTYNWPAALGKVLES
ITAQKRLPDEVIVADDGSGEETRALVARMAANFPVPLRHVWQEDLGFRAARSRNRGMAAS
RGDYVILIDGDMVLHPQFVADHLALAEPGYFLQGGRFKTHPRETERLLAGGKPRFAPWAD
ADFHVFDGIKRLYAFHSLPLARWKSRARSGGRVMSCNTSFWREDLLRINGFDERMEGYGA
EDRELAARMGNAGVTRRQLKWAALAMHLDHASRAQPDVDDMSLPNNRLYRATVEQRITRC
EQGIDRHLAEFAGTGAS