Protein Info for ABZR86_RS13895 in Dyella japonica UNC79MFTsu3.2

Annotation: glycosyltransferase family 39 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 575 transmembrane" amino acids 14 to 32 (19 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 117 to 135 (19 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 168 to 197 (30 residues), see Phobius details amino acids 218 to 238 (21 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details amino acids 309 to 328 (20 residues), see Phobius details amino acids 334 to 352 (19 residues), see Phobius details amino acids 362 to 385 (24 residues), see Phobius details amino acids 405 to 424 (20 residues), see Phobius details amino acids 430 to 449 (20 residues), see Phobius details PF02366: PMT" amino acids 46 to 216 (171 residues), 34.8 bits, see alignment E=1.3e-12 PF13231: PMT_2" amino acids 68 to 204 (137 residues), 53.9 bits, see alignment E=2.7e-18

Best Hits

Predicted SEED Role

"Polymyxin resistance protein ArnT, undecaprenyl phosphate-alpha-L-Ara4N transferase; Melittin resistance protein PqaB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2EF46 at UniProt or InterPro

Protein Sequence (575 amino acids)

>ABZR86_RS13895 glycosyltransferase family 39 protein (Dyella japonica UNC79MFTsu3.2)
MSVAPQATSQERRYFWLLLLFAVVVIGAGIGLRDPWPSDEPRFTLAAKQMVESGDWLFPH
RGAELYSDKPPMLMWTEAASYKLIGNWRIAFLLPSLLAALGTLLLVYDLGRRLWSRQAGL
YAAAALLVSFQFVYQVKRAQIDPLVMFYITAANWGLLVHMLKGPNWRAFWFGCFCAGLGV
ITKGVGVLALFMLVPYVVAWRGGWDGVSRMGPGAWWRWPLGLVALLAAIALWLVPMLLGA
KAHGSDPTYAGYVNDILFHQTAGRYSKSWDHHHSPFYYVPIVLFSWLPLSLTYPGTLPRW
WQRLKAKDARILLPLGWIVLILVFFAIPKGKRDVYIMPALPMLALITGPFLHELLQKRWL
RVAGLVFIGTMGAAMLGVGAAALIAHPKFATEFATARGFDDGGHALWWMFVAIGAVQLIL
IAALRMSRAVWAVCGGMAAMWLAWSLWAYPLLNDSSSAAGLMQDVRERVPANEELGLVAW
KEQNLLMLDRPATDFGFTVPWHEQYVAAVKWQAQDPAHRWLFALDGVMEKCVDRSKAISL
GHANRREWWLFKADAVIPGCTPGEDVDRVPANTAD