Protein Info for ABZR86_RS13830 in Dyella japonica UNC79MFTsu3.2

Annotation: iron-sulfur cluster insertion protein ErpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 125 PF01521: Fe-S_biosyn" amino acids 20 to 120 (101 residues), 71.9 bits, see alignment E=2.6e-24 TIGR00049: iron-sulfur cluster assembly accessory protein" amino acids 22 to 124 (103 residues), 128.3 bits, see alignment E=6.6e-42

Best Hits

Swiss-Prot: 75% identical to ERPA_XANC5: Iron-sulfur cluster insertion protein ErpA (erpA) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: None (inferred from 77% identity to psu:Psesu_0391)

Predicted SEED Role

"probable iron binding protein from the HesB_IscA_SufA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2EFD4 at UniProt or InterPro

Protein Sequence (125 amino acids)

>ABZR86_RS13830 iron-sulfur cluster insertion protein ErpA (Dyella japonica UNC79MFTsu3.2)
MDTVVPFPTVPDYRSAGAPLVFTEAAAHKVRELIQEEGNPSLKLRVYITGGGCSGFQYGF
TFDEAQAEDDFALEREGVTLLVDPLSLQYLTGAEIDYSESLSGSQFVIRNPNAKTTCGCG
SSFSA