Protein Info for ABZR86_RS13755 in Dyella japonica UNC79MFTsu3.2

Annotation: type III secretion system export apparatus subunit SctR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 161 to 186 (26 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details TIGR01102: type III secretion apparatus protein, YscR/HrcR family" amino acids 12 to 216 (205 residues), 258.1 bits, see alignment E=3e-81 PF00813: FliP" amino acids 15 to 216 (202 residues), 236.2 bits, see alignment E=1.6e-74

Best Hits

Swiss-Prot: 41% identical to HRPW_PSESY: Harpin secretion protein HrpW (hrpW) from Pseudomonas syringae pv. syringae

KEGG orthology group: K03226, type III secretion protein SctR (inferred from 51% identity to bcj:BCAM2041)

Predicted SEED Role

"Flagellar biosynthesis protein FliP" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2EH93 at UniProt or InterPro

Protein Sequence (221 amino acids)

>ABZR86_RS13755 type III secretion system export apparatus subunit SctR (Dyella japonica UNC79MFTsu3.2)
MDFNSFSPALVITMVVALAMAPFVAVMVTSFTKIVVVLSLLRNALGLQQVPPNVVINGLA
IILSIYVMNPVIGDSYRDVQTQMSTQAPGPMTMEKLGQLVQSGKEPLRRFLIKHSNEGER
GFFLASAKRLLPPDRQADITNEDYLVIVPAFTVSELTQAFQIGFLIFLPFLVIDLVVSNI
LLAMGMMMLSPTMVSLPFKLLLFVLLSGWAKLIHGLVMTYQ