Protein Info for ABZR86_RS13730 in Dyella japonica UNC79MFTsu3.2

Annotation: type III secretion system export apparatus subunit SctV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 691 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 114 to 137 (24 residues), see Phobius details amino acids 205 to 226 (22 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details amino acids 289 to 326 (38 residues), see Phobius details TIGR01399: type III secretion protein, HrcV family" amino acids 20 to 688 (669 residues), 740.2 bits, see alignment E=1.2e-226 PF00771: FHIPEP" amino acids 32 to 680 (649 residues), 668.6 bits, see alignment E=5.7e-205

Best Hits

Predicted SEED Role

"Flagellar biosynthesis protein FlhA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2EGS0 at UniProt or InterPro

Protein Sequence (691 amino acids)

>ABZR86_RS13730 type III secretion system export apparatus subunit SctV (Dyella japonica UNC79MFTsu3.2)
MALEAIFSRLAPGAGGSRSYSDLVLVAGVVAIIGLMILPLPMVAIDALVALNMLIGVGLL
LIAIYIPTPVAFSSFPSVLLLTTLFRLALSIAITRSILLNADGGHIIDTFGNMVVGGNLI
VGLVVFLIITVVQFIVVAKGAERVAEVAARFSLDAMPGKQLSIDSDLRSGLLEKDEARRR
RRLLEIESQLHGSLDGAMKFVKGDAIAGIVIIVINLLGGLGVGVMMHDMSVGDAVHTYSV
LTIGDGLVAQIPALLASISAGLIVTRTAGDEEDRNLGAIIARQISGEPRVTMIIGCIALG
MMLVPGFPIVVFLPLGVILVGIASWRMRERVGFLRRLFKVPESQAELLPPDVADSDVLLP
SAPLLLEVHMTALQALGSNQVRNLLRQVVGGLREDYGVPLPKPALRAGLQLPEQGYALYA
YGVRIAHGALRPGQLFLPGRAALPPAPSAETGALAPEGVSGFPGRWIPRDGARQAQAQAL
DAQQVLHEHIRMALERHLSLFVGIQETSNLSNGLSRDYPDLVREMLRVVSPQRVAEVLKR
LVEERVPIRQLRDVFEAITDAASREKDIVLVAEYVRMALRRHLSYRYADDNHVLRVLVAR
PELEERLRRSVHTGPAGTQLAVEPDLAARLLAQIGEHARGEHGSAMVLLSSMDVRRHLRK
LTEAEYADIPVLSYQELVPDLRLVPVGQLAV