Protein Info for ABZR86_RS13690 in Dyella japonica UNC79MFTsu3.2

Annotation: FliI/YscN family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 TIGR01026: ATPase, FliI/YscN family" amino acids 26 to 445 (420 residues), 542.8 bits, see alignment E=2.8e-167 PF02874: ATP-synt_ab_N" amino acids 39 to 102 (64 residues), 32.1 bits, see alignment E=2.1e-11 PF00006: ATP-synt_ab" amino acids 159 to 368 (210 residues), 290.9 bits, see alignment E=8.7e-91 PF18269: T3SS_ATPase_C" amino acids 377 to 445 (69 residues), 75.2 bits, see alignment E=4.4e-25

Best Hits

Swiss-Prot: 56% identical to YSCN_YEREN: Probable ATP synthase YscN (yscN) from Yersinia enterocolitica

KEGG orthology group: K03224, ATP synthase in type III secretion protein SctN [EC: 3.6.3.14] (inferred from 60% identity to gpb:HDN1F_20350)

Predicted SEED Role

"Flagellum-specific ATP synthase FliI" in subsystem Flagellar motility or Flagellum

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2EIV4 at UniProt or InterPro

Protein Sequence (449 amino acids)

>ABZR86_RS13690 FliI/YscN family ATPase (Dyella japonica UNC79MFTsu3.2)
MSVSPSDAAPEVMAVPADDPLLRALSRRDTLQRVGRVAEAYGTLVRATGVRAAIGELCLL
EQPDNDFSLPAEVVGVSQHQTLLTPLGPLEGISTATTVTATGKQATAPAGMSLLGRVIDA
HGDPLDGLGPLEQVERVPLYAPSPNPLSRQVIDQAMPTGVRAIDAALTIGRGQRTGIFAV
AGGGKSTLLGMLARNAQADVNVIVLVGERGREVGEFLHDSLGEEGLKRSVVVVATSDRPA
LERSRVAWLGTAIAEYFRDRGMNVLLMMDSITRFARALRDVGLAMGEPPSRRGFTPSVFS
ALPRLFERAGTNDKGAITAFYTVLMEDEDGSDPIAEEVRSILDGHIYLSRRLAQAGHYPA
IDVLASASRLMPRVTGSAHQRAASLLRRYVAKYRDIEMLLQLGEYKPGGDADADTAIARI
DAINQLLRQGTHEAADFAGTRARLTGVCT