Protein Info for ABZR86_RS13650 in Dyella japonica UNC79MFTsu3.2

Annotation: 6-carboxytetrahydropterin synthase QueD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03367: queuosine biosynthesis protein QueD
  • amino acids 3 to 94 (92 residues), 111.3 bits, E=1.1e-36
• PF01242: PTPS
  • amino acids 3 to 116 (114 residues), 130.3 bits, E=1.9e-42

Best Hits

Swiss-Prot: 64% identical to QUED_ECOLI: 6-carboxy-5,6,7,8-tetrahydropterin synthase (queD) from Escherichia coli (strain K12)

KEGG orthology group: K01737, 6-pyruvoyl tetrahydrobiopterin synthase [EC: 4.2.3.12] (inferred from 80% identity to xal:XALc_2721)

MetaCyc: 64% identical to 6-carboxy-5,6,7,8-tetrahydropterin synthase (Escherichia coli K-12 substr. MG1655)
RXN0-5507 [EC: 4.1.2.50]

Predicted SEED Role

"6-carboxytetrahydropterin synthase (EC 4.1.2.50) @ Queuosine biosynthesis QueD, PTPS-I" (EC 4.1.2.50)

MetaCyc Pathways

• erythro-tetrahydrobiopterin biosynthesis I (2/4 steps found)
• threo-tetrahydrobiopterin biosynthesis (2/4 steps found)
• preQ₀ biosynthesis (2/4 steps found)
• drosopterin and aurodrosopterin biosynthesis (4/7 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.50 or 4.2.3.12

Sequence Analysis Tools

See A0A1I2EIF0 at UniProt or InterPro

Protein Sequence (120 amino acids)

>ABZR86_RS13650 6-carboxytetrahydropterin synthase QueD (Dyella japonica UNC79MFTsu3.2)
MHIFKLFHLEAAHRLPNVPPGHKCARLHGHSFRVEIHVAGEPDPHQGWVMDFADVKAAFA
PLYDQLDHHYLNDIEGLENPTSENLARWIFRRLEPRLPGLDKVVVHETCTSGASCSRDSF