Protein Info for ABZR86_RS13620 in Dyella japonica UNC79MFTsu3.2

Annotation: F0F1 ATP synthase subunit delta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00213: OSCP
  • amino acids 7 to 174 (168 residues), 152.7 bits, E=5.5e-49
• TIGR01145: ATP synthase F1, delta subunit
  • amino acids 8 to 174 (167 residues), 124.1 bits, E=3.7e-40

Best Hits

Swiss-Prot: 52% identical to ATPD_XANC8: ATP synthase subunit delta (atpH) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K02113, F-type H+-transporting ATPase subunit delta [EC: 3.6.3.14] (inferred from 52% identity to xal:XALc_2909)

Predicted SEED Role

"ATP synthase delta chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

See A0A1I2EJ88 at UniProt or InterPro

Protein Sequence (177 amino acids)

>ABZR86_RS13620 F0F1 ATP synthase subunit delta (Dyella japonica UNC79MFTsu3.2)
MAQAITLARPYARAAFELARASGALGAWSQALAFAAAVAKDARVAALGNDPRVLPSQLVA
LHLPQGMDAQAPFANFLAELAEHRRMALLPEVAELFEQYKREAESQLLVKVTSAMALDAA
QAEQLKASLKRRFKRDIELETQVDASLLGGVVIDTGSEVIDGSVRGRLARLSGALTA