Protein Info for ABZR86_RS13555 in Dyella japonica UNC79MFTsu3.2

Annotation: MMPL family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 772 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 247 to 264 (18 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details amino acids 297 to 315 (19 residues), see Phobius details amino acids 334 to 354 (21 residues), see Phobius details amino acids 361 to 382 (22 residues), see Phobius details amino acids 414 to 435 (22 residues), see Phobius details amino acids 633 to 652 (20 residues), see Phobius details amino acids 659 to 679 (21 residues), see Phobius details amino acids 685 to 705 (21 residues), see Phobius details amino acids 718 to 738 (21 residues), see Phobius details amino acids 744 to 766 (23 residues), see Phobius details PF03176: MMPL" amino acids 171 to 387 (217 residues), 31.6 bits, see alignment E=4.4e-12

Best Hits

KEGG orthology group: None (inferred from 52% identity to psu:Psesu_2790)

Predicted SEED Role

"FIG021862: membrane protein, exporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2EL32 at UniProt or InterPro

Protein Sequence (772 amino acids)

>ABZR86_RS13555 MMPL family transporter (Dyella japonica UNC79MFTsu3.2)
MPRTGKALLLALWLLALAGLGLLVAQRLKVSGDLRDFMPAPTTFEQRLLMEQVGDGPGSR
LLLLAIDGGDDATLAGLSQGLAGALRGDPRYTQVLNGSFDLAALDEQLLPYRYLLSPTLD
HERYDQAFLADQLDQRLDDLSSPAATLLKGLLPRDPTLEVLKLAERWTPAHTPDVREGVW
FSPKGEALLVVQTKAAGFDPAAQGEAMNGIEQAFRRLSKTGGAHLSISGPGYFSVVVGEH
TRHEAEWIGNVSTAGFILLLLLAYRSFGSLLLSALPIASAALGGIAALVLVFPQVHGITL
AFGFTLLGVAQEYPIRVLSHRRAGENAVASVRALWPLLLTAIASACIAYLAFYASGVNGL
QQLAVFTITGLLVAGLCTRYLLPRLLPAQVRDVADMPWLARARGFFDRLPRPRWLPAAVA
VAIVIALAVAPGAFWQNNLAALTPLPPDLLQRDARLREALGAPDVRYLLVLQAADAQSVL
RLSEQLEPEVDALVARHAADAIELPSRYLPSIATQQERQRRLPDAVALRASLAAATQGMP
FRQDLFEPFLADVAKAKALPPLTPEAFARSALGQRLAAMLVQREHQWLGLGTLSGVHDVA
ALDALAKDSGGAVRVLDLKAAAESLVADYRVRILHALAIAAVLLVLTVSFALRGWRRAWR
VLAPMTLATFLVLAVERAAGVEISLFHLVALTLAAGLGLHYALFFERDTDEVAEQRRTLH
ATLVCVASALLVFGMFAWSSIPVLRAIGLTVSLGVAFHFCLSTLMAPHARTD