Protein Info for ABZR86_RS13495 in Dyella japonica UNC79MFTsu3.2

Annotation: YifB family Mg chelatase-like AAA ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 TIGR00368: Mg chelatase-like protein" amino acids 8 to 498 (491 residues), 644 bits, see alignment E=7.4e-198 PF13541: ChlI" amino acids 21 to 142 (122 residues), 142.8 bits, see alignment E=1.5e-45 PF01078: Mg_chelatase" amino acids 191 to 394 (204 residues), 333 bits, see alignment E=1.7e-103 PF07728: AAA_5" amino acids 214 to 350 (137 residues), 35.2 bits, see alignment E=3.7e-12 PF00493: MCM" amino acids 289 to 353 (65 residues), 25.7 bits, see alignment E=1.8e-09 PF13335: Mg_chelatase_C" amino acids 406 to 498 (93 residues), 96.2 bits, see alignment E=4.5e-31

Best Hits

KEGG orthology group: K07391, magnesium chelatase family protein (inferred from 62% identity to psu:Psesu_0144)

Predicted SEED Role

"MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2ELW3 at UniProt or InterPro

Protein Sequence (500 amino acids)

>ABZR86_RS13495 YifB family Mg chelatase-like AAA ATPase (Dyella japonica UNC79MFTsu3.2)
MSLAVTLSRAQEGVAAPQVMVEVHLSGGLPGTNIVGLPEAAVREARDRVRVAIQNTAFEY
PNRRVTVNLAPAELPKDGGRFDLAIALGILAAGNQVPRERLDNCEFLGELALSGALRGVS
GVLPALMRARARGRKVVVPRANAAEAALISDADVRVADSLAEVCGWLRGTQDLPTPAAAP
ANDEVAGDGPDLRDVRGQRHARRALEIAAAGGHHLLLVGPPGTGKTMLAERLPGILPPLS
ESEALETCAVLSVSGQPVEAGRWRRRPFRSPHHTASAVALVGGGSHPRPGEISLAHHGVL
FLDELPEFTRHVLDVLREPLESGSIVISRAARQSTFPAQFQLVAAMNPCPCGYAGDPRER
CRCTPDQVQRYRGRVSGPLLDRIDLCVDVPRQPLSELGATRGEHDEDSATVRARVLAARH
HAMQRAGRSNAEISTRELERDCALGPTERTWFEAALERLGLSARAYHRTLRVARTIADLD
GGAASLARVHLAEALQYRRF