Protein Info for ABZR86_RS13490 in Dyella japonica UNC79MFTsu3.2

Annotation: isocitrate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01346: isocitrate lyase
  • amino acids 9 to 248 (240 residues), 351 bits, E=4.9e-109
  • amino acids 249 to 425 (177 residues), 279.7 bits, E=2e-87
• PF00463: ICL
  • amino acids 14 to 248 (235 residues), 193.9 bits, E=4.6e-61
  • amino acids 250 to 425 (176 residues), 157 bits, E=6.8e-50
• PF13714: PEP_mutase
  • amino acids 79 to 273 (195 residues), 57.9 bits, E=1.2e-19

Best Hits

Swiss-Prot: 72% identical to ACEA_BACHD: Isocitrate lyase (aceA) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K01637, isocitrate lyase [EC: 4.1.3.1] (inferred from 86% identity to sml:Smlt0232)

MetaCyc: 67% identical to isocitrate lyase subunit (Mycobacterium tuberculosis H37Rv)
Isocitrate lyase. [EC: 4.1.3.1]

Predicted SEED Role

"Isocitrate lyase (EC 4.1.3.1)" in subsystem Serine-glyoxylate cycle (EC 4.1.3.1)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• glyoxylate cycle (6/6 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.1

Sequence Analysis Tools

See A0A1I2EM95 at UniProt or InterPro

Protein Sequence (433 amino acids)

>ABZR86_RS13490 isocitrate lyase (Dyella japonica UNC79MFTsu3.2)
MKNNLPTAEQITLDWQNNPRWNGVRRNYTAADVVRLRGTVPVEHSIARHGAERLWKSLQQ
EDFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLAGEMYPDQSLYPANSVPQVVK
RINNTLLRADQLHHAEGNDEIDWMVPIVADAEAGFGGVLNAFELMKAMIEAGASGVHFED
QLASVKKCGHMGGKVLVPTREAVDKLTAARLAADVLGVPTLLVARTDADAADLLTSDIDD
NDRPFVTGERTVEGFFRVRPGLDQAISRGLAYAPYADLVWCETSKPNLEEARRFAEAIHA
QFPGKLLAYNCSPSFNWKKNLDDATIARFQRELGAMGYKFQFITLAGFHSLNYGMFDLAH
GYARRQMSAFVELQEREFAAAERGFTAVKHQREVGTGYFDQVTQAIQQGQSSTTALKGST
EEAQFHARRASAA