Protein Info for ABZR86_RS13455 in Dyella japonica UNC79MFTsu3.2

Annotation: ubiquinone biosynthesis regulatory protein kinase UbiB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 548 transmembrane" amino acids 501 to 521 (21 residues), see Phobius details amino acids 527 to 545 (19 residues), see Phobius details TIGR01982: 2-polyprenylphenol 6-hydroxylase" amino acids 9 to 445 (437 residues), 563.5 bits, see alignment E=1.3e-173 PF03109: ABC1" amino acids 94 to 342 (249 residues), 259.4 bits, see alignment E=1.3e-81

Best Hits

Swiss-Prot: 66% identical to UBIB_XANCP: Probable protein kinase UbiB (ubiB) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K03688, ubiquinone biosynthesis protein (inferred from 63% identity to smt:Smal_0175)

Predicted SEED Role

"Ubiquinone biosynthesis monooxygenase UbiB" in subsystem Ubiquinone Biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2ENS1 at UniProt or InterPro

Protein Sequence (548 amino acids)

>ABZR86_RS13455 ubiquinone biosynthesis regulatory protein kinase UbiB (Dyella japonica UNC79MFTsu3.2)
MTPLKFVPRVLRVASVLLAYRLDELVDAAHLFRPLKLLRPFLAKPRADVANLPRGARLRL
ALTELGPIFVKAGQVLSTRRDLVPGDIADELALLQDQVPPFPGAEARAIVERELKAPVTQ
LFARFDETPLASASIAQVHAALLPDGREVVVKVLRPGIDARIARDVALLHSLGELAQRWH
PNADKIRPLDVVAEVEKMLENELDLQREGASASLLRRNFESGVDLYVPEVHWELTAERVL
TLERVNGVSCDDIAAIDAAGVDRKTLAAKGVRVFYEQVFRDNFFHADAHPGNIWVDVTRS
TEPRFIALDFGIMGSLPEADQYWLAQNFIALFERDYARIAQLHVDAGWMPNTVRMDELEA
AVRTVCEPYFTRPLSQISLAELVVKLFQTARRFELTLQPQLILLQKTLLNIEGVGRMLDP
DIDIWAVAHPVLKRILRERYSPRRTLREMRKRVPEWFHAAPQFPELIRDALRQVARGEQR
RLADPLELAQRQETAHRQQRTIGAGLFGSALLVSATVLWTQAPQHGAWLPLGVAIAGLFS
FIAGWPRR