Protein Info for ABZR86_RS13370 in Dyella japonica UNC79MFTsu3.2

Annotation: twin-arginine translocase subunit TatC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 120 to 144 (25 residues), see Phobius details amino acids 167 to 193 (27 residues), see Phobius details amino acids 203 to 220 (18 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details TIGR00945: twin arginine-targeting protein translocase TatC" amino acids 19 to 236 (218 residues), 227.4 bits, see alignment E=9.4e-72 PF00902: TatC" amino acids 21 to 231 (211 residues), 241.2 bits, see alignment E=5e-76

Best Hits

Swiss-Prot: 54% identical to TATC_AZOCH: Sec-independent protein translocase protein TatC (tatC) from Azotobacter chroococcum mcd 1

KEGG orthology group: K03118, sec-independent protein translocase protein TatC (inferred from 63% identity to psu:Psesu_2959)

MetaCyc: 52% identical to twin arginine protein translocation system - TatC protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-181

Predicted SEED Role

"Twin-arginine translocation protein TatC" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Twin-arginine translocation system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2EPE6 at UniProt or InterPro

Protein Sequence (256 amino acids)

>ABZR86_RS13370 twin-arginine translocase subunit TatC (Dyella japonica UNC79MFTsu3.2)
MAAPEQEPHTEDGALEEGLFSHLIELRSRLMRAIVTIALVLLALIPIANRLYAELAAPLV
ARLPQGAHLIATEVASPFVTPLKLAFYAALFISMPMILYQLWAFVSPGLYKHEKRLARPL
LAAALVLFYTGCAFAYFLVLPAAFRFLTAVTPEGVEMMTDITHYLDFVMLMFFAFGLCFE
VPVAVVILAAIGVVNLQQLRDGRRYAIVGAFTIAAFITPPDITSMIMLAVPMCFLYEVGL
LAVRWLVKPATEAAAP