Protein Info for ABZR86_RS13355 in Dyella japonica UNC79MFTsu3.2

Annotation: peptidoglycan DD-metalloendopeptidase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF01551: Peptidase_M23" amino acids 296 to 387 (92 residues), 72.9 bits, see alignment E=1e-24

Best Hits

KEGG orthology group: None (inferred from 35% identity to xfn:XfasM23_2161)

Predicted SEED Role

"Exonuclease SbcC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2EMT7 at UniProt or InterPro

Protein Sequence (395 amino acids)

>ABZR86_RS13355 peptidoglycan DD-metalloendopeptidase family protein (Dyella japonica UNC79MFTsu3.2)
MPNLRCCVRPIGAVVLLLAALAAAPAFAQEKTRTEQAEAQKKLAEVRSKMEALAKEQAET
AARRDSANAELAKRANAVAGAAKAVRQTDAELSGKQRELEKLQQDRAALQKNLDGQRAAI
ADLLRATYTLGRGSDLRLLLGDDDVARVARALAYSKYFQEDRVQKVQKLMGDLARLQDLE
ARIATEQQALQATKAQRQEQAKTLEQQRAEQARLAAQTDAQYKDQGERLAQLKQNAQSLN
SLVDKLQKAIDDAAREAAKAAKANPAAPSVSPGKGSANIRGNLPWPANGVVNTYGNGVLI
KANGGSEVRAVARGRVVYAAFLRGYGMLLILNHGNGWLSMYGNNETLLHGVGDEVDTGQA
VGTAAAPTGVNTGVYFELRQNNKPVDPRSWLGRQR