Protein Info for ABZR86_RS13350 in Dyella japonica UNC79MFTsu3.2

Annotation: S41 family peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR00225: C-terminal processing peptidase" amino acids 62 to 378 (317 residues), 327.7 bits, see alignment E=3.7e-102 PF00595: PDZ" amino acids 110 to 177 (68 residues), 26 bits, see alignment E=1.9e-09 PF13180: PDZ_2" amino acids 110 to 188 (79 residues), 45.8 bits, see alignment E=1.2e-15 PF17820: PDZ_6" amino acids 127 to 177 (51 residues), 40.9 bits, see alignment 2.9e-14 PF03572: Peptidase_S41" amino acids 209 to 372 (164 residues), 178.1 bits, see alignment E=2.2e-56

Best Hits

KEGG orthology group: K03797, carboxyl-terminal processing protease [EC: 3.4.21.102] (inferred from 52% identity to nwa:Nwat_0028)

Predicted SEED Role

"Carboxyl-terminal protease (EC 3.4.21.102)" (EC 3.4.21.102)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.102

Use Curated BLAST to search for 3.4.21.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2EP80 at UniProt or InterPro

Protein Sequence (452 amino acids)

>ABZR86_RS13350 S41 family peptidase (Dyella japonica UNC79MFTsu3.2)
MRFPSLPLVALLLAVPALPLQALPAKGAKPAAEPAKAASTAAPDAVDMDDIRNFSRVYEM
VRQAYVEKVDNKTLMKAAISGMLTGLDPHSEYLDKDGLAELSEDTTGQYGGLGIEVLQVD
GTLRIIAPIDDTPASRAGIKPGDTIVKVDGTPVDSENIDEMFKKLRGDPGSKIVLSVLHE
KSDKPVDMSLVRERISVTSVKVRELEPGYAYVRLSQFQDDTASDLEKKLGELVKKNGPQR
GAILDLRSNPGGLLTAAVGVSDAFLDSGTIVTTRGRLQDANLSFAAHPGDLLNGSPMVVL
VDNGTASAAEIVSGALKDNHRALIIGRRTFGKGVVQTVLPLDAEHAVKITTARYYTPSGT
SIQAEGIKPDIALADLAVNKADSAATLIGSEADLRNHLANEDGNSKDRKDLDNDGSAENA
KLATQDYALSQALNVLKGLALNHGVPAQAARQ