Protein Info for ABZR86_RS13225 in Dyella japonica UNC79MFTsu3.2

Annotation: HAD family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 PF00702: Hydrolase" amino acids 9 to 186 (178 residues), 111.2 bits, see alignment E=1.7e-35 PF13419: HAD_2" amino acids 11 to 186 (176 residues), 104.7 bits, see alignment E=1.3e-33 PF12710: HAD" amino acids 11 to 183 (173 residues), 39.3 bits, see alignment E=1.9e-13 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 77 to 188 (112 residues), 35.4 bits, see alignment E=1.2e-12 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 107 to 186 (80 residues), 31.8 bits, see alignment E=1.7e-11 PF13242: Hydrolase_like" amino acids 149 to 207 (59 residues), 40 bits, see alignment E=6.2e-14

Best Hits

KEGG orthology group: None (inferred from 74% identity to bph:Bphy_5294)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2EQK7 at UniProt or InterPro

Protein Sequence (229 amino acids)

>ABZR86_RS13225 HAD family hydrolase (Dyella japonica UNC79MFTsu3.2)
MHRPRSSTAFLFDLDGTLVDSVYQHVLAWKEALDAEGVELSVWRIHRKIGMSGGLFTNIL
LRETGLEITEERLARLHQRHVEAFNRQHSQGLVRPLPGARELLAYLTEQGYPWAIATSGR
MATAAHNIEALGVDPSKVPVITRDQVRHAKPDPDLFLAAAEKLGVDIEQSLVIGDSIWDM
LAAQRARALGVGLLSGGYGEDELARSGAFRVYDDPADLLKHIDEVAARQ