Protein Info for ABZR86_RS13110 in Dyella japonica UNC79MFTsu3.2

Annotation: type II secretion system inner membrane protein GspF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 170 to 193 (24 residues), see Phobius details amino acids 223 to 240 (18 residues), see Phobius details amino acids 371 to 397 (27 residues), see Phobius details TIGR02120: type II secretion system protein F" amino acids 4 to 404 (401 residues), 441.3 bits, see alignment E=2.1e-136 PF00482: T2SSF" amino acids 71 to 194 (124 residues), 112.6 bits, see alignment E=6.3e-37 amino acids 275 to 396 (122 residues), 96.2 bits, see alignment E=7.1e-32

Best Hits

Swiss-Prot: 54% identical to GSPF_XANCP: Type II secretion system protein F (xpsF) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K02455, general secretion pathway protein F (inferred from 57% identity to smt:Smal_0547)

Predicted SEED Role

"General secretion pathway protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2ETH4 at UniProt or InterPro

Protein Sequence (405 amino acids)

>ABZR86_RS13110 type II secretion system inner membrane protein GspF (Dyella japonica UNC79MFTsu3.2)
MSQFHYRAVSDGGDIVQGEMEAASVEEVIARLQDQGHTPLEARPANEAGSAGGLGGLFKR
GPFTGDQLAQFTHQLATLLGAGQPLDRALGILMDLPEGERAKKLIERVRDRVRGGTTLSQ
AFDEEHGVFPKLYISLVRAGEAGGSLEDTLRRLADYLERSQQLRGSIVNALIYPAFLMVG
VLGSLVLLLAYVVPQFVPIFEDMQVPIPLITQAVLALGNLIQSWWWLLMLVIGGGIFVWR
ARLRDPVYRLAWHGRLLQKRLVGPLLLKVETARIARTLGTLVKNGVPLLSALTIARQVTS
NRALDEALAQAAEQVKGGAGLSLALAQSQRFPRLALQMVQVGEEAGQLDTMLLKVADTFE
LESKRAIDRLLAALVPALTIVMTIMVAIIMAAILLPLLSLTSNIQ