Protein Info for ABZR86_RS13105 in Dyella japonica UNC79MFTsu3.2

Annotation: type II secretion system major pseudopilin GspG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details PF07963: N_methyl" amino acids 2 to 25 (24 residues), 25.7 bits, see alignment 6.3e-10 TIGR01710: type II secretion system protein G" amino acids 4 to 132 (129 residues), 109.9 bits, see alignment E=9.9e-36 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 4 to 25 (22 residues), 25.8 bits, see alignment 6.6e-10 PF08334: T2SSG" amino acids 29 to 131 (103 residues), 106.8 bits, see alignment E=6.4e-35

Best Hits

Swiss-Prot: 47% identical to GSPG_XANCP: Type II secretion system protein G (xpsG) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K02456, general secretion pathway protein G (inferred from 74% identity to psb:Psyr_3149)

Predicted SEED Role

"General secretion pathway protein G"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2ESI2 at UniProt or InterPro

Protein Sequence (132 amino acids)

>ABZR86_RS13105 type II secretion system major pseudopilin GspG (Dyella japonica UNC79MFTsu3.2)
MRARGFTLLEMLAVIVLIGIIGAVVVTQVGKNVDKGKYGAGKAQLTTLSQKIENYALDNG
SPPQQLQDLIAKPANARNWQGPYAKESELKDPWGHAFGYKYPGEHGSFDLVFYGQDGQPG
GDGYNADAGNWQ