Protein Info for ABZR86_RS13065 in Dyella japonica UNC79MFTsu3.2

Annotation: type II secretion system secretin GspD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 792 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR02517: type II secretion system protein D" amino acids 98 to 763 (666 residues), 483.9 bits, see alignment E=3.5e-149 PF21305: type_II_gspD_N0" amino acids 99 to 167 (69 residues), 35.8 bits, see alignment E=9e-13 PF03958: Secretin_N" amino acids 195 to 253 (59 residues), 40.6 bits, see alignment 3.7e-14 amino acids 260 to 326 (67 residues), 38.2 bits, see alignment E=2.1e-13 amino acids 334 to 505 (172 residues), 38.3 bits, see alignment E=1.9e-13 PF00263: Secretin" amino acids 592 to 753 (162 residues), 166.9 bits, see alignment E=4.7e-53

Best Hits

KEGG orthology group: K02453, general secretion pathway protein D (inferred from 54% identity to pst:PSPTO_3307)

Predicted SEED Role

"General secretion pathway protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2EU60 at UniProt or InterPro

Protein Sequence (792 amino acids)

>ABZR86_RS13065 type II secretion system secretin GspD (Dyella japonica UNC79MFTsu3.2)
MSPYFIKPACRIGTLALAVWMAGCASMPPPKDDGALQREAMAGTEKPVPPPLPLNTGLNP
PDGKSIAPQISEGSGNFIRPSALATPRTPASGDGAVTFNFENQPVQAVVKAILGDLLKQN
YTIAPGVQGNISFATAEPVDSSQAMPILETLLSWTGNALIKRNGGYVVVPAKEAVAGNLV
PSLGASAPAAGMQARLFPLRYISAAEMQKLIKPFARPESILLVDPSRNLVVLAGSPQELA
NYQRTINTFDVDWLRGMSVGVFNLQRASVAELMPKLDGMFGAKGDTPLAGMLRFIPIERT
NALVVISTQPNYLQEVGQWIEKIDRGGGNEPQLFVYDVRNIKASDLAQYLAQIYASGGGN
GGSGGRVGPGLNSSTLGGADNANGSGSGMGSLAGSFGSNTTGGLGGNSNGLNSGINSGIN
SGAGFNNGTDSSKTSGFGGPGASIGSTFGSQQNGSGGNQAPQQYSSEDGSVRISSVDSNN
QLLVRARPSQWAEIESAIKRLDNTPLQVQIETRILEVKLTGQFQFGVQWYLEGLIGGTNN
GNGTYTPGQPGNQQQWGLGQGGVTYNPGTSTSAGDAFFYSFINHNLQVAVRALEQNGNTK
TLSAPSLVVLNNQIAQIQVGDQVPINQTSVNPGVGTATYNQVNYLNTGVILNVQPRVNPG
GLVYLNVQQQVSSPTYPAGASNPTISQRSMGTQVAVQSGQTVLLGGLISQQDGTTDTGIP
GLNRIPVVGRLFGSTNRNRTRTELIVLITPKVIGSSEEAKQITDEYQQKFESLAPLRQGQ
ATAPAAQPYPTK