Protein Info for ABZR86_RS12995 in Dyella japonica UNC79MFTsu3.2

Annotation: ankyrin repeat domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1100 1154 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 58 (21 residues), see Phobius details amino acids 72 to 95 (24 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 170 to 194 (25 residues), see Phobius details amino acids 200 to 221 (22 residues), see Phobius details PF12796: Ank_2" amino acids 274 to 366 (93 residues), 27.8 bits, see alignment E=7.5e-10 amino acids 350 to 434 (85 residues), 34.8 bits, see alignment 5.1e-12 amino acids 446 to 533 (88 residues), 45.1 bits, see alignment 3e-15 amino acids 509 to 592 (84 residues), 36.2 bits, see alignment 1.9e-12 amino acids 770 to 849 (80 residues), 45.5 bits, see alignment 2.3e-15 amino acids 870 to 957 (88 residues), 46.8 bits, see alignment 9.1e-16 amino acids 966 to 1041 (76 residues), 29.4 bits, see alignment 2.4e-10 PF13637: Ank_4" amino acids 350 to 393 (44 residues), 23.8 bits, see alignment (E = 1.2e-08) amino acids 765 to 809 (45 residues), 24.3 bits, see alignment (E = 7.7e-09) amino acids 868 to 915 (48 residues), 33.7 bits, see alignment (E = 8.7e-12) PF00023: Ank" amino acids 373 to 403 (31 residues), 21.4 bits, see alignment (E = 5.8e-08) amino acids 504 to 532 (29 residues), 17.1 bits, see alignment (E = 1.4e-06) amino acids 766 to 795 (30 residues), 20.5 bits, see alignment (E = 1.2e-07) amino acids 928 to 958 (31 residues), 15.4 bits, see alignment (E = 4.8e-06) amino acids 964 to 992 (29 residues), 21.6 bits, see alignment (E = 5.1e-08) PF13857: Ank_5" amino acids 751 to 802 (52 residues), 28.5 bits, see alignment (E = 4.1e-10)

Best Hits

Predicted SEED Role

"Ankyrin-like protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2EVV3 at UniProt or InterPro

Protein Sequence (1154 amino acids)

>ABZR86_RS12995 ankyrin repeat domain-containing protein (Dyella japonica UNC79MFTsu3.2)
MSYSKTRRPPPFLQGLLWFVPGLLAVAVAALSASPLSLIPLLLANALTMAAVCHAIGFDP
EPQFLRTVLRRGAAHLVMFTGYVVLVFLLVAWPMLKLNQAHSLGATLLLAGALVVALAAL
WRMWPAFGLVYVWDDAYPPQSDGSWIFTATARSIAFGRHLSREERFFTHYLPAAIALLAL
AFAAIALAGLYGVLPPELRIAALALYGVVLLPLGCLVIANRTLRALLCEGRRPARPSAPA
RAEATPAPPPKPAPVLNEQERTAGTPEQAQALLAATRDGDIERALALIEAGADPNTAPPS
GDRDQRPVLMLAALLPDTRLLRALIAKGADVNRASGGLTPLLAATRDSWHGRPDAVMTLL
ANGASPLAVDAEGNTALHGAVHSGEPIVAAMLLDAGAPVNALNRARVSPLATACRAANWP
LVKFLLEHGAKPTPPDGEPALVAAAGIAEDDAEGVRLLLKHRAAVNAVDSRHRSALMEAA
GEGHEQISRALRTAGADVTLADRHGRTALMEAARAGKVGIVQLLAEAQPDARVRDVHGRD
ALTLACQSPQAHAETVRALLALGAEAKTPGADGRSALDHAAAAGRWDLVALLDPDTPLPT
NLRFDEALAEGADTPAHLLDALRFGHWAIVSTFTQRVKEWPASQLAQLYLDLAGPGLGAA
RRWLLEHALAPEARLQPQLVDDAEVLEGIDATLPPLGRRLFDALLPQLPAAAEAIEDLLA
AGASPAGAGLLAQALQRLDDSAAASSFALGLLERGADPFGPDARERTPVHLAAAQGQLPV
LQALLVRGGDPNTRDTQGRTPLFAALEHGEKALPLVRVLVAHGADAEATDANGETPLGLA
FDHPEIERWLDWGDWTRPRRPLRADDLPAAAAAGALAAVDRLLELGFPVNTQDRQGATAL
LHACGMGHREVAARLLDGGADSSLAAANGMTPLAAAVAARRDTLVALLLEHDANVDARLP
GEATALMVAAAMGYPEIAEQLLEGGADIQAVDTRGHGALHAAAQFGFEQNDSLRARRLFD
VLLKRGADVNAADKEGMSPLQLLLGAHLRPGSPCDATHIGALVPVLLDAGARIEHADQRG
VTALHACAMHALLPPARVLLARGADRSAADTFGRTAADVARALGLVDIAHELAARAGAMP
SVRQTLRQPAQPAE