Protein Info for ABZR86_RS12930 in Dyella japonica UNC79MFTsu3.2

Annotation: cytochrome c oxidase subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 51 to 72 (22 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details PF02790: COX2_TM" amino acids 27 to 108 (82 residues), 48.7 bits, see alignment E=7e-17 TIGR02866: cytochrome c oxidase, subunit II" amino acids 51 to 273 (223 residues), 198.6 bits, see alignment E=4.2e-63 PF00116: COX2" amino acids 125 to 264 (140 residues), 120.5 bits, see alignment E=3.8e-39

Best Hits

KEGG orthology group: K02275, cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 56% identity to psu:Psesu_0174)

Predicted SEED Role

"Cytochrome c oxidase polypeptide II (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2EUD8 at UniProt or InterPro

Protein Sequence (316 amino acids)

>ABZR86_RS12930 cytochrome c oxidase subunit II (Dyella japonica UNC79MFTsu3.2)
MTSGGIRIKAWVATICALFAGAAWANPEPGQLNMTRGVTEWSSEPYFLNNVALGVCIVIG
IVVFGAMFVAMFRFRKSRGAVAEKWSHNTTLEVVWTTIPVIILIVLAYLATGGLKSFADT
TNSQMTVKVTGFQWKWRYDYVEYQGKALDKVGFMSKLDKESDETRQLKSGLDPNAVKVDG
YNTYLINVDEPLVVPVGTKIRFVITAGDVIHSWWVPALGWKMDAIPGIVNAAWTNIKEPG
VYRGQCAELCGQDHGFMPIVVKAVPKAEFEQWLAQKQQAAQPQPPAQQQPAAPAPASSSA
APKTAQAAAPATSHQG