Protein Info for ABZR86_RS12925 in Dyella japonica UNC79MFTsu3.2

Annotation: cytochrome c oxidase subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 513 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 52 to 75 (24 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 132 to 159 (28 residues), see Phobius details amino acids 172 to 199 (28 residues), see Phobius details amino acids 224 to 247 (24 residues), see Phobius details amino acids 258 to 279 (22 residues), see Phobius details amino acids 291 to 312 (22 residues), see Phobius details amino acids 326 to 349 (24 residues), see Phobius details amino acids 363 to 385 (23 residues), see Phobius details amino acids 405 to 424 (20 residues), see Phobius details amino acids 443 to 465 (23 residues), see Phobius details TIGR02891: cytochrome c oxidase, subunit I" amino acids 2 to 500 (499 residues), 687.3 bits, see alignment E=6e-211 PF00115: COX1" amino acids 7 to 448 (442 residues), 532.3 bits, see alignment E=4.6e-164

Best Hits

Swiss-Prot: 57% identical to COX1_BRADU: Cytochrome c oxidase subunit 1 (ctaD) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02274, cytochrome c oxidase subunit I [EC: 1.9.3.1] (inferred from 77% identity to xom:XOO_3919)

MetaCyc: 76% identical to cytochrome c oxidase subunit 1 (Pseudomonas putida KT2440)

Predicted SEED Role

"Cytochrome c oxidase polypeptide I (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2EWA9 at UniProt or InterPro

Protein Sequence (513 amino acids)

>ABZR86_RS12925 cytochrome c oxidase subunit I (Dyella japonica UNC79MFTsu3.2)
MSTNHKDIGTLYLVFSLLMFFIGGSFAMVIRAELFKPGLQLVQPYFFNEMTTMHALVMIF
GAVMPAFVGLGNWMIPLMIGAPDMALPRMNNLSFWILPFAFTLLLSTLFMPGGGPAGGWT
MYPPLSLQGDSVAPLVFAVHLMGISSIMGAINIIATILNMRAPGMDLLKMPVFVWSWLIT
AFLLIAVMPVLAGAVTMLLTDKYFGTSFFNAAGGGDPVLFQHIFWFFGHPEVYIMILPAF
GIISEVIPTFARKPIFGYKAMVFAIASIAFLSFIVWAHHMFAVGLPLGAEIFFMYATMLI
AVPTGVKVFNWVSTMWGGSMTFETPMLFAVAFVILFTIGGFSGLMLALVPADFQYHDSYF
VVAHFHYVLVTGAIFAIIAATYYWLPKWTGHMYSEFWGKVHFWNSVIWVNVLFFPQHFLG
LAGMPRRIPDYNVAFANFNMISSIGGFLFGASQLIFLGVLVHAVWFSKKKAADRVWEGAK
GLEWTVPSPAPYHTFELPPVIHEDELAHGHVED