Protein Info for ABZR86_RS12900 in Dyella japonica UNC79MFTsu3.2

Annotation: heme A synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details amino acids 131 to 148 (18 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 220 to 240 (21 residues), see Phobius details amino acids 296 to 314 (19 residues), see Phobius details amino acids 326 to 345 (20 residues), see Phobius details amino acids 352 to 371 (20 residues), see Phobius details PF02628: COX15-CtaA" amino acids 12 to 366 (355 residues), 227.3 bits, see alignment E=1.3e-71

Best Hits

Predicted SEED Role

"Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2EV18 at UniProt or InterPro

Protein Sequence (391 amino acids)

>ABZR86_RS12900 heme A synthase (Dyella japonica UNC79MFTsu3.2)
MSTRSVKILRGLALLAAVFAFGVVMFGAFVRLSNAGLSCPDWPTCYGKATWPEHQHEIAK
ANEAFPDRPYETHKAWREQVHRFLAGTLGMLVFALALIASWRRPWARYAVIVSAILAAVG
VTMYMRGEHSISSVVSAFAIGLPLLAAARLDRPGAWRISVLAFGVIIFQAMLGMWTVTLL
LKPIVVMGHLLGGIATFALLAYAALRYAGVGARDDSYAALRRLVVIGIVLLLAQIALGGW
TSANYAALACGTDFPKCLGQWTPPTDFEQGFVLWRGVGVNYEGGVLDMAARSAIQLAHRL
GALVVFCYLAWLALRATRRGLRGHGLAIAAVLVAQVLLGISNVHFGLPLPVATLHNGVAA
LLLFVLLATLARTQRRPDDAIFSRSIFQGLG