Protein Info for ABZR86_RS12895 in Dyella japonica UNC79MFTsu3.2

Annotation: heme o synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 40 to 61 (22 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 161 to 184 (24 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details amino acids 232 to 252 (21 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details TIGR01473: protoheme IX farnesyltransferase" amino acids 6 to 282 (277 residues), 325.2 bits, see alignment E=2.3e-101 PF01040: UbiA" amino acids 19 to 265 (247 residues), 230.5 bits, see alignment E=1e-72

Best Hits

Swiss-Prot: 65% identical to CYOE_STRM5: Protoheme IX farnesyltransferase (cyoE) from Stenotrophomonas maltophilia (strain R551-3)

KEGG orthology group: K02301, protoheme IX farnesyltransferase [EC: 2.5.1.-] (inferred from 75% identity to psu:Psesu_0183)

MetaCyc: 37% identical to heme O synthase (Escherichia coli K-12 substr. MG1655)
HEMEOSYN-RXN [EC: 2.5.1.141]

Predicted SEED Role

"Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA" in subsystem Biogenesis of cytochrome c oxidases

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.- or 2.5.1.141

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2EW52 at UniProt or InterPro

Protein Sequence (302 amino acids)

>ABZR86_RS12895 heme o synthase (Dyella japonica UNC79MFTsu3.2)
MSRVNEYMELTKPRVVALLVFCAVIGMFLAVPGVPPWRALVFGTLGIWLASASAAAFNHL
IDQRIDKLMARTAHRPLATGHLTPRQVMVFALALGVLSMLILVLLVNPLTALLTFGGLIG
YAVVYTAYLKRATPQNIVIGGLAGAIPPVLGWTAVTGELHAFAVQLCLIIFVWTPPHFWA
LAIFRRDDYSRAQVPMLPVTHGVVYTRWHVLLYTVLLFLVTLLPSLTGYSGLVYLGGAVV
LGAGFLYYAVRLLNPPDELFAMKVFNYSIVYLMALFAFLLADHWLVDPLLQQGQGFVLQR
AT