Protein Info for ABZR86_RS12885 in Dyella japonica UNC79MFTsu3.2

Annotation: magnesium-translocating P-type ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 886 transmembrane" amino acids 80 to 98 (19 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 278 to 299 (22 residues), see Phobius details amino acids 305 to 332 (28 residues), see Phobius details amino acids 693 to 710 (18 residues), see Phobius details amino acids 716 to 734 (19 residues), see Phobius details amino acids 755 to 778 (24 residues), see Phobius details amino acids 789 to 808 (20 residues), see Phobius details amino acids 819 to 840 (22 residues), see Phobius details amino acids 856 to 878 (23 residues), see Phobius details TIGR01524: magnesium-translocating P-type ATPase" amino acids 31 to 885 (855 residues), 1291.7 bits, see alignment E=0 PF00690: Cation_ATPase_N" amino acids 35 to 95 (61 residues), 59.9 bits, see alignment 4.5e-20 PF00122: E1-E2_ATPase" amino acids 142 to 341 (200 residues), 129.6 bits, see alignment E=2.9e-41 TIGR01494: HAD ATPase, P-type, family IC" amino acids 254 to 391 (138 residues), 67.2 bits, see alignment E=9.7e-23 amino acids 594 to 715 (122 residues), 107.8 bits, see alignment E=4.9e-35 PF00702: Hydrolase" amino acids 357 to 640 (284 residues), 55.3 bits, see alignment E=3.6e-18 PF13246: Cation_ATPase" amino acids 387 to 467 (81 residues), 42.2 bits, see alignment E=2e-14 PF00689: Cation_ATPase_C" amino acids 709 to 877 (169 residues), 75.3 bits, see alignment E=1.6e-24

Best Hits

Swiss-Prot: 56% identical to ATMA_SALT1: Magnesium-transporting ATPase, P-type 1 (mgtA) from Salmonella typhimurium (strain 14028s / SGSC 2262)

KEGG orthology group: K01531, Mg2+-importing ATPase [EC: 3.6.3.2] (inferred from 62% identity to pao:Pat9b_3006)

Predicted SEED Role

"Mg(2+) transport ATPase, P-type (EC 3.6.3.2)" (EC 3.6.3.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2EX55 at UniProt or InterPro

Protein Sequence (886 amino acids)

>ABZR86_RS12885 magnesium-translocating P-type ATPase (Dyella japonica UNC79MFTsu3.2)
MIKHSTHSVAGKAAGKGAGAPVRVAVALEAFRHNEALFAALDTSAAGLDAEQIAERLDRD
GANEVSHEKPPHWSRQLLRAFKNPFIIVLLVLAVVQLATDGDDLAGPIIIAVMVGISVLL
SFTQEFRSSKAAEKLKAMVRNTATVTRRSEDGHSERIEVPVGELVAGDIVHLAAGDMVPA
DLRLFSAKDLFISQAILTGESLPVEKSAPTPAQVSEEAAQGDNPLDLPTVCYMGTNVVSG
SASAVVVATGSRTYLGSLAHTIVGQRVRTSFDRGVNSVSWLLIRFMLVMVPIVFAINWYD
KGDFLQAFLFALSVAVGLTPEMLPLIVTANLGKGAIAMSKRKVVVKRLNAIQNFGAMDVL
CTDKTGTLTLDKIVLERHLDLYGEESDEALEYGYLNSRFQTGLKNLMDKAVLEHRDLETV
AQQYRIVDEIPFDFQRRRMSVVVRHGEGDELLVCKGAVEEMLSICAYAKVGEEILPVTDE
MRADIKAMTRDLNEDGLRVLVVAVKHQPPAGRAYGVADESGLTAVGCLAFLDPPKDSAAT
AIAALHHHGVEVKVITGDNEAVTRKICREVGLDVQHSAQGKHIEPLNDEELDALVKRTTV
FAKMSPLQKARVVKSLQRQGHTVGFLGDGINDAPALREADVGISVDTATDIAKESADIIL
LEKNLMVLEEGVIEGRITFGNIIKYIKMTASSNFGNMFSVLVASAFLPFLPMLPLQILVL
NLLYDISQLSIPFDRMDDEYLRKPRKWDASDIGRFMVWIGPVSSIFDITTFLLLWYVFGA
NGPAHQSFFQSGWFVESLLTQTLIVHMIRTKRIPFLQSVAAAPVLGLTTAIIAIGLLLPY
TGLGAKIGMMPLPPVYFAWIALTVLTYCVLTQLVKLLYIRRYGRWL