Protein Info for ABZR86_RS12870 in Dyella japonica UNC79MFTsu3.2

Annotation: alpha/beta fold hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 PF01738: DLH" amino acids 14 to 129 (116 residues), 22.8 bits, see alignment E=2.5e-08 PF12146: Hydrolase_4" amino acids 25 to 262 (238 residues), 78.4 bits, see alignment E=2.1e-25 PF00561: Abhydrolase_1" amino acids 28 to 268 (241 residues), 59 bits, see alignment E=2.4e-19 PF12697: Abhydrolase_6" amino acids 29 to 276 (248 residues), 46.1 bits, see alignment E=3.8e-15 PF02129: Peptidase_S15" amino acids 47 to 257 (211 residues), 54.2 bits, see alignment E=7.3e-18 PF00326: Peptidase_S9" amino acids 49 to 136 (88 residues), 35.7 bits, see alignment E=2.7e-12

Best Hits

Swiss-Prot: 58% identical to YPT2_ECOLX: Uncharacterized 31.7 kDa protein in traX-finO intergenic region from Escherichia coli

KEGG orthology group: None (inferred from 59% identity to bgl:bglu_2g07600)

Predicted SEED Role

"Dienelactone hydrolase and related enzymes"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2EW92 at UniProt or InterPro

Protein Sequence (286 amino acids)

>ABZR86_RS12870 alpha/beta fold hydrolase (Dyella japonica UNC79MFTsu3.2)
MHKQTVHIGDAPLAATLHLPDSPGPHATVLLCHGFCGTQPLLLPAFAAAFAQAGYVAVTF
DYRGFGESGGERGRLVPSMQIDDILAVLGWLKTHDQVDAQRIGLWGTSLGGGHVMGAAAR
DAGVRCVVSQLAFADGEEVIAGHMSAEEKASFLATLAKMEERKQAGKEMFVPLTRVLGDP
ESKAFFEKHKDSYPELSIKIPMLTVKEMFHYKPATDAAHVTCPTLVVVAGDDGVNPPAQG
TALFDAVGAATKQLYVQEGARHYDAYEGTHFDQVAQRQLAWYGQHL