Protein Info for ABZR86_RS12820 in Dyella japonica UNC79MFTsu3.2

Annotation: DUF1328 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 56 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 33 to 55 (23 residues), see Phobius details PF07043: DUF1328" amino acids 6 to 44 (39 residues), 44.3 bits, see alignment E=9.3e-16

Best Hits

Swiss-Prot: 60% identical to Y3976_AGRRK: UPF0391 membrane protein Arad_3976 (Arad_3976) from Agrobacterium radiobacter (strain K84 / ATCC BAA-868)

KEGG orthology group: None (inferred from 60% identity to ara:Arad_3976)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2EY45 at UniProt or InterPro

Protein Sequence (56 amino acids)

>ABZR86_RS12820 DUF1328 domain-containing protein (Dyella japonica UNC79MFTsu3.2)
MLKWAIIFAIVSLVTGWLGFYSVSGVTGTIAKVLFAIFLILFLIAVLAAIGLFHIV