Protein Info for ABZR86_RS12790 in Dyella japonica UNC79MFTsu3.2

Annotation: 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01498: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
  • amino acids 4 to 130 (127 residues), 101.5 bits, E=2e-33
• PF01288: HPPK
  • amino acids 5 to 130 (126 residues), 103.6 bits, E=4.5e-34

Best Hits

Swiss-Prot: 46% identical to HPPK_PSEAE: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (folK) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00950, 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC: 2.7.6.3] (inferred from 60% identity to sml:Smlt4031)

Predicted SEED Role

"2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC 2.7.6.3)" in subsystem Folate Biosynthesis (EC 2.7.6.3)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis IV (Plasmodium) (2/3 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (3/5 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis III (Chlamydia) (3/5 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis V (Pyrococcus) (1/4 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis II (Methanocaldococcus) (2/7 steps found)
• superpathway of chorismate metabolism (38/59 steps found)
• tetrahydromethanopterin biosynthesis (3/14 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.7.6.3

Use Curated BLAST to search for 2.7.6.3

Sequence Analysis Tools

See A0A1I2EWQ2 at UniProt or InterPro

Protein Sequence (160 amino acids)

>ABZR86_RS12790 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase (Dyella japonica UNC79MFTsu3.2)
MARVYLSLGSNLQPQRYLRAALDELRARFGAIEVSPAYRSKAVGFDGPDFVNLAVGLDTE
LAPEALNEWLHALEDRHGRRRDVPRYADRTLDVDIVLYDDLVRQGAGHLDIPRKELQHAF
VLRPIADIAPGLRHPVDGRSMAELWAAFPVASEPLTVEPL