Protein Info for ABZR86_RS12780 in Dyella japonica UNC79MFTsu3.2

Annotation: pteridine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF00106: adh_short" amino acids 9 to 190 (182 residues), 135.4 bits, see alignment E=3.6e-43 PF08659: KR" amino acids 10 to 127 (118 residues), 32.6 bits, see alignment E=1.6e-11 PF13561: adh_short_C2" amino acids 19 to 243 (225 residues), 163.1 bits, see alignment E=1.7e-51 PF23441: SDR" amino acids 119 to 244 (126 residues), 36.6 bits, see alignment E=6.9e-13

Best Hits

KEGG orthology group: K03793, pteridine reductase [EC: 1.5.1.33] (inferred from 62% identity to xal:XALc_0833)

Predicted SEED Role

"FolM Alternative dihydrofolate reductase 1" in subsystem Folate Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2EZH9 at UniProt or InterPro

Protein Sequence (248 amino acids)

>ABZR86_RS12780 pteridine reductase (Dyella japonica UNC79MFTsu3.2)
MPPRQESPVALITGGAKRVGAQIARSLHAAGYDLALHCRRSVAEAAELAAELEALRPGST
LILQAELAELDALHALVDTTLARYGRLDALVNNASAFYPTPVGSATAAQWNELFASNAQA
PFFLAQAAVPALRESRGAIVNLVDVYAERPLAKHPIYCMAKAALAAMTRSLALDLGPDIR
VNGVAPGAVMWPSDGKPYDDQQTMLARTPLRRAGSPQDVAAAVLWLLRDAPFVTGQILRI
DGGRSLSI