Protein Info for ABZR86_RS12760 in Dyella japonica UNC79MFTsu3.2

Annotation: LTA synthase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 666 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 51 to 80 (30 residues), see Phobius details amino acids 92 to 115 (24 residues), see Phobius details amino acids 147 to 164 (18 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details PF00884: Sulfatase" amino acids 283 to 551 (269 residues), 149.1 bits, see alignment E=9.5e-48

Best Hits

KEGG orthology group: None (inferred from 46% identity to gur:Gura_1625)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2EZS2 at UniProt or InterPro

Protein Sequence (666 amino acids)

>ABZR86_RS12760 LTA synthase family protein (Dyella japonica UNC79MFTsu3.2)
MSAADSSASPLRQRFRPLWWLAFAYVAIGAITRVALLVMSGKGVPHNPLYWAYAFGVGLL
YDLVTYIYIAWPLVLFLWLMPRRAYVSRAGQWALYLLAAVLLYWLMFVGASELVFWNEFG
TRFNFIAVDYLVYTTEVIGNIRESYPLGRWLSLLALAVLIALLVSRRGLRTRDGGTRFWQ
RAKVALVWLVLTVVTVAAFKGTLKDRTDNNFVNELSGNGIYEFFAAFRSSHLEYSRFYTT
LPGDQAYRDVRTMLKTPEATFVSNDPRDLTREIRHEGPEKRLNVVLISIESFSADFMQTF
GDDRGITPNLDALIDKSLFFDNLYANGTRTVRGLEALSLAIPPTPGDSLIKAHNNEDLFS
VANVFNARGYQSDFVYGGYGYFDNMNYFFNHNGYRAVDRNDINKDDPIHHENVWGVADED
LYTLAMRQMDSIHAQGKPFFLHIMTTSNHRPFTVPAGRVKEKNGTREAAVAYTDWSIADF
LKRAASKPYFDDTIFVITADHCASSAGRTSVPINRYHIPLWIYAPKHIQPQRVHRLMAQI
DIMPTVLGMLNFSYRSRFFGYDLFQLEPGRERAFPATYEKLGYLRDDVLTVLEPQRKLEQ
MRPDYETGDGTPVQPVDRAKVDEATAYYQVAADLYKLRQLGKRPEDNTPVQPLQAGQGSG
ATPVLH