Protein Info for ABZR86_RS12750 in Dyella japonica UNC79MFTsu3.2

Annotation: complex I NDUFA9 subunit family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF01370: Epimerase" amino acids 7 to 115 (109 residues), 52.3 bits, see alignment E=1.6e-17 PF03435: Sacchrp_dh_NADP" amino acids 7 to 79 (73 residues), 30.6 bits, see alignment E=1.2e-10 PF01073: 3Beta_HSD" amino acids 7 to 117 (111 residues), 32.8 bits, see alignment E=1.2e-11 PF05368: NmrA" amino acids 7 to 111 (105 residues), 38.5 bits, see alignment E=2.8e-13 PF13460: NAD_binding_10" amino acids 10 to 147 (138 residues), 83.5 bits, see alignment E=5.2e-27

Best Hits

KEGG orthology group: K00329, NADH dehydrogenase [EC: 1.6.5.3] K00356, NADH dehydrogenase [EC: 1.6.99.3] (inferred from 41% identity to noc:Noc_0390)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3, 1.6.99.3

Use Curated BLAST to search for 1.6.5.3 or 1.6.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2EXF0 at UniProt or InterPro

Protein Sequence (311 amino acids)

>ABZR86_RS12750 complex I NDUFA9 subunit family protein (Dyella japonica UNC79MFTsu3.2)
MNAKRLVILGGTGFVGSYLVPRLAMDGHRIVLLSRNRERRRALAVVPGVEIRSTDVYDAN
ALRRQFEGADAVIHMIGSLHAAGGHSLQEIHVELARRVAAACHAAGIGRLHLMSALKAGQ
GLSQYLKTRGEAETAVRQSGLDWTIYQSSVMFGANDGLVSRFAALLKMMPVLPLARAGSR
LAPTYAGDVAEAIVRCVANDPLGIDRSFELYGPEVLTLGEIVHGIRDTLGLRTRIVPLPD
ALGRVQARFAELLPGKPFSYDSFLTLCTDSVGEQDGYAALDIRPQPLTPWLPVLLQGSRR
QQRLDRYRAMR