Protein Info for ABZR86_RS12715 in Dyella japonica UNC79MFTsu3.2

Annotation: c-type cytochrome

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF00034: Cytochrom_C" amino acids 84 to 148 (65 residues), 33.2 bits, see alignment E=1.1e-11 amino acids 164 to 254 (91 residues), 42.9 bits, see alignment E=1.1e-14 PF13442: Cytochrome_CBB3" amino acids 164 to 251 (88 residues), 26.5 bits, see alignment E=6.8e-10

Best Hits

Predicted SEED Role

"Cytochrome c4" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2EYX9 at UniProt or InterPro

Protein Sequence (267 amino acids)

>ABZR86_RS12715 c-type cytochrome (Dyella japonica UNC79MFTsu3.2)
MSFRPAGSRPAVLGYAVALVFALSASIAAAQDAKPAAATSAKPAAAASAATAAQPAAEKP
ATAGAETAHSGVKLGDATAGQGKAAACGACHGMDGNSSDPQYPKLAGQSEQYIVQQLGNF
KSGKRQNPIMMGMAAPLSEQDMHDIGAYFAGKTALPGVADQALVERGEQLYRQGDAAKGV
PACMACHSIDGRGNPGALYPQLTSQHAQYIQATLKAMHDGTSWGDDAHAKIMPSIAQKLD
EKDIAALASYVEGLHAADGAAAKPATP