Protein Info for ABZR86_RS12710 in Dyella japonica UNC79MFTsu3.2

Annotation: ribosome biogenesis GTP-binding protein YihA/YsxC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 TIGR03598: ribosome biogenesis GTP-binding protein YsxC" amino acids 9 to 202 (194 residues), 212.6 bits, see alignment E=1.9e-67 PF01926: MMR_HSR1" amino acids 28 to 156 (129 residues), 58.1 bits, see alignment E=4.5e-20

Best Hits

Swiss-Prot: 53% identical to ENGB_STRMK: Probable GTP-binding protein EngB (engB) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K03978, GTP-binding protein (inferred from 55% identity to smt:Smal_3402)

Predicted SEED Role

"GTP-binding protein EngB" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2EZT7 at UniProt or InterPro

Protein Sequence (213 amino acids)

>ABZR86_RS12710 ribosome biogenesis GTP-binding protein YihA/YsxC (Dyella japonica UNC79MFTsu3.2)
MAPNPLQGASFVLAAHRIDQLPADSGGEVAFAGRSNAGKSSALNKLTGHHGLARTSKTPG
RTQQMVAFALPPLAQGEGMPPLDVRLIDLPGYGYAKVPEPLREHWKREIDAYLHQRRSLR
GVVLIVDIRHPLKEFDRMMLAFCQDTALPCHVLLTKADKLSRNQSAQALAAMRKQFAAEG
LLATAQVFSSAEGTGVDEAREAVVALLRRERGV