Protein Info for ABZR86_RS12610 in Dyella japonica UNC79MFTsu3.2

Annotation: transcription termination factor Rho

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 580 TIGR00767: transcription termination factor Rho" amino acids 163 to 579 (417 residues), 681.4 bits, see alignment E=2.3e-209 PF07498: Rho_N" amino acids 166 to 209 (44 residues), 52.1 bits, see alignment 8.2e-18 PF07497: Rho_RNA_bind" amino acids 213 to 287 (75 residues), 116.2 bits, see alignment E=6.8e-38 PF00006: ATP-synt_ab" amino acids 322 to 525 (204 residues), 94.2 bits, see alignment E=1.4e-30

Best Hits

Predicted SEED Role

"Transcription termination factor Rho" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2EZV3 at UniProt or InterPro

Protein Sequence (580 amino acids)

>ABZR86_RS12610 transcription termination factor Rho (Dyella japonica UNC79MFTsu3.2)
MSDIESQDQNDAKSAEPKTVSETPRTRAPRKSAASATAAAESAPRVEKPASEAPPPAPVQ
ASLPVDPAPAAHGDAASREGAPPQAREGGQPQQQGGGQNPNNDRRNDRNDRGRRRRHERN
NNPQQQQRGPGGQGGGQQHPRNNNGLPVDDDYADAGSNDRLINLTELKRKNAIQLLEFAE
SLGIQEGVARARKQDVVFNILKAHARSGGGIWAEGVLEILQDGFGFLRSADESYLAGPDD
IYVSPSQIRRFNLRTGDYITGRVRHPKEGERYFALLKVDDINGDPPEASKNKMLFENLTP
LFPRKAFHLERGNGSTEDITGRILDLVAPVGRGQRGLIVSQPKSGKTMMLQNVAQAIQYN
HPDVHLIMLLIDERPEEVTEIARTVRAEVISSTFDEPAVRHVQVAEMVIERAKRLVEHKK
DVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALQRPKRFFGAARNVEEGGSLTIIAT
ALTDTGSKMDEVIYEEFKGTGNMEVHLNRRISEKRVYPAIDINRSGTRREDLLIDPDMLS
KIWILRKLLHPMDELAAMEFMLDKMKNTKTNDEFFNSMKR