Protein Info for ABZR86_RS12590 in Dyella japonica UNC79MFTsu3.2

Annotation: permease-like cell division protein FtsX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 38 to 61 (24 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 220 to 234 (15 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details amino acids 283 to 305 (23 residues), see Phobius details PF18075: FtsX_ECD" amino acids 77 to 169 (93 residues), 44.2 bits, see alignment E=2.5e-15 PF02687: FtsX" amino acids 192 to 303 (112 residues), 32.6 bits, see alignment E=7.3e-12

Best Hits

KEGG orthology group: K09811, cell division transport system permease protein (inferred from 44% identity to xcb:XC_3846)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2F2M3 at UniProt or InterPro

Protein Sequence (315 amino acids)

>ABZR86_RS12590 permease-like cell division protein FtsX (Dyella japonica UNC79MFTsu3.2)
MVAEPRVERSRPRPVASWRDHHAWSAGASLRRLMSRPVGTLLTVAVMALALALPLTFYLL
LGNVQKMGQALGQNQAVSVFMQPGQTGPAVEMMATKLRERADVASVAIKSPQQGMDELAR
MQGFSGALNTLDSNPLPYALEVLPKPEASADDVARLVTDLRALQGVDLVQDSGTWRQRLD
ALLGVGNRVVLILAALLALAVLLVVGNTVRVDIASRSEEIGVLMLIGASGAFVRRPYLYA
GIWYGLFSGLLAAGMALLIEMALAEPVTRLGHVYEGKLQIGMLPLWLLGAVPLAAAVLGW
LGARLVSAWQLRKAA