Protein Info for ABZR86_RS12545 in Dyella japonica UNC79MFTsu3.2

Annotation: transaldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 TIGR00874: transaldolase" amino acids 8 to 321 (314 residues), 495.2 bits, see alignment E=4.4e-153 PF00923: TAL_FSA" amino acids 19 to 317 (299 residues), 325.7 bits, see alignment E=1.4e-101

Best Hits

Swiss-Prot: 70% identical to TAL_ALTMD: Transaldolase (tal) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K00616, transaldolase [EC: 2.2.1.2] (inferred from 70% identity to amc:MADE_03321)

MetaCyc: 65% identical to transaldolase B (Escherichia coli K-12 substr. MG1655)
Transaldolase. [EC: 2.2.1.2]

Predicted SEED Role

"Transaldolase (EC 2.2.1.2)" in subsystem Folate Biosynthesis or Fructose utilization or Pentose phosphate pathway (EC 2.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.2

Use Curated BLAST to search for 2.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2JEA9 at UniProt or InterPro

Protein Sequence (322 amino acids)

>ABZR86_RS12545 transaldolase (Dyella japonica UNC79MFTsu3.2)
MTDSAVSNQLEQLRQYTTVVADTGDIDAIARYRPVDATTNPSLLLKATELPAYAPLIDEA
VQWAKGQSASREQQLVDASDYLAVAAGRKIAELVPGRVSTEVDARLSFDTNATITKAERL
IGLYAAAGVQRERILIKIASTWEGIRAAEALERRGIQCNLTLLFSFEQAVACAEAGVYLI
SPFVGRIMDWYVANTSTKTYAPAEDPGVLSVRRIYSWYKQHGFDTVVMGASFRNIGQIQA
LAGCDRLTISPDLLEKLEATSEPLPRALQDNGEREARLQPLDEAAFRWGHNEDAMATEKL
ADGIRKFAADQRKLEAMLAARL