Protein Info for ABZR86_RS12505 in Dyella japonica UNC79MFTsu3.2

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08659: KR
  • amino acids 14 to 177 (164 residues), 31.3 bits, E=3.8e-11
• PF00106: adh_short
  • amino acids 14 to 204 (191 residues), 165 bits, E=3.1e-52
• PF01370: Epimerase
  • amino acids 15 to 186 (172 residues), 21.1 bits, E=3.8e-08
• PF13561: adh_short_C2
  • amino acids 19 to 255 (237 residues), 199.6 bits, E=1.2e-62

Best Hits

KEGG orthology group: K08081, tropine dehydrogenase [EC: 1.1.1.206] (inferred from 66% identity to xal:XALc_2868)

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

MetaCyc Pathways

• tropane alkaloids biosynthesis (2/11 steps found)
• superpathway of hyoscyamine (atropine) and scopolamine biosynthesis (4/16 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis II
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.206

Sequence Analysis Tools

See A0A1I2JEU6 at UniProt or InterPro

Protein Sequence (260 amino acids)

>ABZR86_RS12505 SDR family oxidoreductase (Dyella japonica UNC79MFTsu3.2)
MNNRIDAWQLQGHTALITGASKGIGYAVARELAGLGANLLLVARDDDHLEQVRVELADDF
DHIEVLAFAADLSMQEDRLAVFDWIADLGAPLSLLVNNAGGNTPAAVLEYSERDYRAIFE
LNLFSAFEMCRLAHPQLVQHANAAIVNVGSVSGITHVRTGAAYGMSKAALHQLTRNLAAE
WATDGIRVNAVAPWYIRTQRSEPALADDEYLDEVLDHTPLRRIGEPEEVAAAIAFLCLPA
ASYITGQVLAVDGGFLNYGF