Protein Info for ABZR86_RS12290 in Dyella japonica UNC79MFTsu3.2

Annotation: mechanosensitive ion channel domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 87 to 116 (30 residues), see Phobius details PF05552: MS_channel_1st_1" amino acids 15 to 54 (40 residues), 27.9 bits, see alignment 3.5e-10 PF21088: MS_channel_1st" amino acids 62 to 102 (41 residues), 24.3 bits, see alignment 5.2e-09 PF00924: MS_channel_2nd" amino acids 104 to 170 (67 residues), 61.1 bits, see alignment E=1.8e-20 PF21082: MS_channel_3rd" amino acids 177 to 258 (82 residues), 54.8 bits, see alignment E=2.1e-18

Best Hits

Swiss-Prot: 42% identical to MSCS_ECO57: Small-conductance mechanosensitive channel (mscS) from Escherichia coli O157:H7

KEGG orthology group: K03442, small conductance mechanosensitive channel (inferred from 48% identity to dol:Dole_2296)

MetaCyc: 42% identical to small conductance mechanosensitive channel MscS (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2K423 at UniProt or InterPro

Protein Sequence (274 amino acids)

>ABZR86_RS12290 mechanosensitive ion channel domain-containing protein (Dyella japonica UNC79MFTsu3.2)
MHDFLVRLHFSESAIQHLIDIAVALLILLLGLWIAARVANFALRAMQRAKFDPTLSGFLR
NLINGVLIVLLVVMALQQAGVPSAPLIAALSTAGLAIGLALQGSLSNLAWGVLLIVFRPF
RVGDYITAGGIDGTVDSISLMHTLLVLPDNREAIVPNGKIGADAIVNFNRRGTRRFELKV
GIGYGDDIGKAMAAVRELFEADERILQDPAPGIWTESLGDSAVNLVIRAFTRTGDLWGAQ
TDLLRRIKERFDAEGISIPFPQRELRVVQGKLPD