Protein Info for ABZR86_RS12280 in Dyella japonica UNC79MFTsu3.2

Annotation: dihydrolipoyl dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00364: Biotin_lipoyl
  • amino acids 6 to 77 (72 residues), 73.7 bits, E=3.9e-24
• TIGR01350: dihydrolipoyl dehydrogenase
  • amino acids 130 to 582 (453 residues), 499.7 bits, E=3.8e-154
• PF07992: Pyr_redox_2
  • amino acids 130 to 450 (321 residues), 208 bits, E=9.9e-65
• PF12831: FAD_oxidored
  • amino acids 131 to 168 (38 residues), 32.5 bits, 2.8e-11
• PF01134: GIDA
  • amino acids 131 to 192 (62 residues), 21.8 bits, E=4.2e-08
• PF00070: Pyr_redox
  • amino acids 299 to 372 (74 residues), 58.2 bits, E=4.4e-19
• PF02852: Pyr_redox_dim
  • amino acids 469 to 577 (109 residues), 127.3 bits, E=1.3e-40

Best Hits

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 73% identity to xac:XAC3659)

MetaCyc: 62% identical to dihydrolipoamide dehydrogenase (Advenella mimigardefordensis DPN7)
Dihydrolipoyl dehydrogenase. [EC: 1.8.1.4]; 1.8.1.- [EC: 1.8.1.4]

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of pyruvate dehydrogenase complex (EC 1.8.1.4)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (3/3 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• 3,3'-disulfanediyldipropannoate degradation (1/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.8.1.4

Sequence Analysis Tools

See A0A1I2GVT0 at UniProt or InterPro

Protein Sequence (594 amino acids)

>ABZR86_RS12280 dihydrolipoyl dehydrogenase (Dyella japonica UNC79MFTsu3.2)
MANTIEVKVPDIGGHDSVPVIEVLVKAGDSVTKDQSLITLESDKATMEIPSSAAGTIKEV
KVKVGDELSEGAVIVILEVSGDAAAPAAEAPKAAAAPAPAPASAPAPAKAAAPAPQAAGA
SGRTADIECKLVVLGSGPGGYTAAFRAADLGVDTVLVERYATLGGVCLNVGCIPSKALLH
AAAVIDEAEAMAAHGVSFGKPKLDLDKLRSFKNKVVGQLTGGLAGMSRQRKVRTVQGVGS
FVSPHELEVETAEGKKLVRFEHAIIAAGSQSVKLPAFPWDDERVMDSTGALELKDVPGKL
LVVGGGIIGLEMATVYAALGSEVTVVEFMDQLIPGADADLIKPLAKRLGGKLKGVHLKTK
VTEAKATKKGIEVAYEGDSIPETKLFDRVLVAVGRSPNGGKIGADKAGVAVTERGFINVD
TQMRTNVPHIFAIGDLVGQPMLAHKATHEARVAAEVVAGMKSHFDARVIPSVAFTDPEVA
WVGVTEREAKEKGLKIGVGKFPWAASGRAIGIDRTEGFTKLIFDEETHRVVGGAIVGPHA
GDLIAEITHAIEMGSEAADIGLTIHPHPTLSESVGMAAEVYEGTITDLYMPKRK