Protein Info for ABZR86_RS12265 in Dyella japonica UNC79MFTsu3.2

Annotation: 4-hydroxy-tetrahydrodipicolinate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 34% identical to DAPB_OCEIH: 4-hydroxy-tetrahydrodipicolinate reductase (dapB) from Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)

KEGG orthology group: K00215, dihydrodipicolinate reductase [EC: 1.3.1.26] (inferred from 66% identity to cau:Caur_1276)

Predicted SEED Role

"4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8)" (EC 1.17.1.8)

MetaCyc Pathways

superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
aspartate superpathway (21/25 steps found)
L-lysine biosynthesis I (9/9 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
L-lysine biosynthesis III (6/7 steps found)
L-lysine biosynthesis VI (6/7 steps found)
L-lysine biosynthesis II (7/9 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.8, 1.3.1.26

Use Curated BLAST to search for 1.17.1.8 or 1.3.1.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2GV14 at UniProt or InterPro

Protein Sequence (267 amino acids)

>ABZR86_RS12265 4-hydroxy-tetrahydrodipicolinate reductase (Dyella japonica UNC79MFTsu3.2)
MTLNVCLAGATGWAGSELARGLAVADGLKLVSAVSRKHAGATLAQALGDERLDAPVFATA
AEALSKPVDVFMEYTRPDSAKANILAALEHGAHVVVGTSGLSDEDYARIDEAARAKGRAV
LACGNFALTMVLLQKFAEQAAKYIPSWEIIDYAYEGKPDAPSGTVRELAGRLGKVRQPEP
GLPLEKTNGVRETRGGTLGGAQVHAVRLPGFVLGAEVIFGMPDQTLTLRHNAGSSAKPYV
DGALLAIRKVSGLAPGLHRGLDKVLEL