Protein Info for ABZR86_RS12200 in Dyella japonica UNC79MFTsu3.2

Annotation: ribulose-phosphate 3-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00834: Ribul_P_3_epim
  • amino acids 7 to 204 (198 residues), 297.7 bits, E=1.7e-93
• TIGR01163: ribulose-phosphate 3-epimerase
  • amino acids 7 to 217 (211 residues), 314.4 bits, E=1.5e-98

Best Hits

Swiss-Prot: 80% identical to RPE_ECOLI: Ribulose-phosphate 3-epimerase (rpe) from Escherichia coli (strain K12)

KEGG orthology group: K01783, ribulose-phosphate 3-epimerase [EC: 5.1.3.1] (inferred from 80% identity to enc:ECL_04748)

MetaCyc: 80% identical to ribulose-phosphate 3-epimerase (Escherichia coli K-12 substr. MG1655)
Ribulose-phosphate 3-epimerase. [EC: 5.1.3.1]

Predicted SEED Role

"Ribulose-phosphate 3-epimerase (EC 5.1.3.1)" in subsystem Calvin-Benson cycle or Conserved gene cluster associated with Met-tRNA formyltransferase or Pentose phosphate pathway or Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 5.1.3.1)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (16/17 steps found)
• Bifidobacterium shunt (14/15 steps found)
• pentose phosphate pathway (8/8 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• heterolactic fermentation (14/18 steps found)
• pentose phosphate pathway (partial) (3/3 steps found)
• Rubisco shunt (8/10 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
• Calvin-Benson-Bassham cycle (9/13 steps found)
• ethene biosynthesis V (engineered) (17/25 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (17/26 steps found)
• oxygenic photosynthesis (10/17 steps found)

KEGG Metabolic Maps

• Carbon fixation in photosynthetic organisms
• Pentose and glucuronate interconversions
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.1

Sequence Analysis Tools

See A0A1I2GVZ3 at UniProt or InterPro

Protein Sequence (222 amino acids)

>ABZR86_RS12200 ribulose-phosphate 3-epimerase (Dyella japonica UNC79MFTsu3.2)
MKQPNVIAPSILSADFARLGEDTAKALAAGADWVHFDVMDNHYVPNLTMGPMVLKALRDY
GITAPIDVHLMVRPVDRIVPDFAKAGASVISFHPEASEHVDRTIGLIKDSGCQAGLVFNP
ATPLNWLDHVLDKLDLVLIMSVNPGFGGQKFIPHALEKLREVRRRIDESGRAIRLEVDGG
VTADNIGQIGAAGADTFVAGSAVFNAPDYRAVIEAMHKQLGA