Protein Info for ABZR86_RS12130 in Dyella japonica UNC79MFTsu3.2

Annotation: diaminopimelate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01048: diaminopimelate decarboxylase
  • amino acids 18 to 417 (400 residues), 472.4 bits, E=4.9e-146
• PF01168: Ala_racemase_N
  • amino acids 40 to 236 (197 residues), 29.4 bits, E=9.5e-11
• PF02784: Orn_Arg_deC_N
  • amino acids 41 to 286 (246 residues), 210.1 bits, E=5.3e-66
• PF00278: Orn_DAP_Arg_deC
  • amino acids 282 to 375 (94 residues), 96.8 bits, E=1.1e-31

Best Hits

Swiss-Prot: 51% identical to DCDA_PSEAE: Diaminopimelate decarboxylase (lysA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01586, diaminopimelate decarboxylase [EC: 4.1.1.20] (inferred from 50% identity to kvu:EIO_0593)

Predicted SEED Role

"Diaminopimelate decarboxylase (EC 4.1.1.20)" in subsystem Lysine Biosynthesis DAP Pathway (EC 4.1.1.20)

MetaCyc Pathways

• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• aspartate superpathway (21/25 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-lysine biosynthesis II (7/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.20

Use Curated BLAST to search for 4.1.1.20

Sequence Analysis Tools

See A0A1I2GYR8 at UniProt or InterPro

Protein Sequence (426 amino acids)

>ABZR86_RS12130 diaminopimelate decarboxylase (Dyella japonica UNC79MFTsu3.2)
MQHSKLPADDSPNPDALFDGVDLRRLAERIPTPFHAYSANAIRTRIAGLQQALHGFDALL
CYAVKANSNLAILQLMAEAGVGADIVSSGELWRALHAGIPAQRIVFSGVGKTAAEIAEAL
AAGILRFNVESADELELLQRMAAELHVVAHAAVRINPDVDAQTHAKISTGKAENKFGVSI
DEARRWFADSARQANVRLDGLHVHIGSQILSVEPFRLAFARVAAFWRELEAAGHAIASID
VGGGLGVRYRDGQVPIPPGDYAAAIREALAGFRGRLLLEPGRYLVAEAGVLLTRVVRVKH
GERRRFLVLDAAMNDLLRPSLYDAWHDIVPLLDDARPPHRYDVVGPVCETGDTFAVEREL
PELHAGELVLIRTTGAYGAAMASTYNSRPLAAEVLLDRGRHAIVRRRQSLEDMVAGEQPA
RHWETA