Protein Info for ABZR86_RS12115 in Dyella japonica UNC79MFTsu3.2

Annotation: DUF819 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 53 (24 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 156 to 180 (25 residues), see Phobius details amino acids 212 to 231 (20 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 267 to 288 (22 residues), see Phobius details amino acids 294 to 316 (23 residues), see Phobius details amino acids 323 to 347 (25 residues), see Phobius details amino acids 354 to 380 (27 residues), see Phobius details PF05684: DUF819" amino acids 14 to 380 (367 residues), 255.7 bits, see alignment E=3.8e-80

Best Hits

KEGG orthology group: None (inferred from 40% identity to bmq:BMQ_0466)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2GUY8 at UniProt or InterPro

Protein Sequence (382 amino acids)

>ABZR86_RS12115 DUF819 family protein (Dyella japonica UNC79MFTsu3.2)
MIQTVWPYLVLMLLAAGAFPALERQFGWRIFNVLPPIVLTYLLVTALAVSGLWKNTAEIQ
AAQGMLVERMVPALVFLLMINCDLRAIFALGPRVLAVFACTSVSLFTAFVLTYLMFRHWL
PGDAWHPLAALSGSWMGGTANMIAVKQAIGMSDTHLAMSLLTDALCYSMWVVVLFSVARL
APAFNRWTRATSSAELVVAQTRQDSPPTTDSVLLWLGLALLVAAGSAWLGARLPASGMVS
PTTWTILLATGLGLVAAHTPLARLPGAGKISGTLLVAVVAVLASQSNFEGMGRAPLYLLC
GVCIIGIQAVLLALFAKLFRFDLYLCGISSLAHIGGVAATPVLAATYARPLVPVGVLLAL
LGYILGTGFGLLVASVLSMLSA