Protein Info for ABZR86_RS12070 in Dyella japonica UNC79MFTsu3.2

Annotation: anthranilate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 PF02885: Glycos_trans_3N" amino acids 13 to 75 (63 residues), 59 bits, see alignment E=3.1e-20 TIGR01245: anthranilate phosphoribosyltransferase" amino acids 16 to 343 (328 residues), 415.8 bits, see alignment E=6.9e-129 PF00591: Glycos_transf_3" amino acids 85 to 334 (250 residues), 305.5 bits, see alignment E=3.5e-95

Best Hits

Swiss-Prot: 76% identical to TRPD_XANAC: Anthranilate phosphoribosyltransferase (trpD) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K00766, anthranilate phosphoribosyltransferase [EC: 2.4.2.18] (inferred from 76% identity to xac:XAC0480)

Predicted SEED Role

"Anthranilate phosphoribosyltransferase (EC 2.4.2.18)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 2.4.2.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2GXS0 at UniProt or InterPro

Protein Sequence (351 amino acids)

>ABZR86_RS12070 anthranilate phosphoribosyltransferase (Dyella japonica UNC79MFTsu3.2)
MNGAGRSITITPQEALQRTIEHREIFHDEMIELMRQIMRGEVSPLMTAAIITGLRVKKET
IGEITGAARVMRELAEKVEAAPHAHFVDIVGTGGDGASSFNISTASMFVAAAAGARVAKH
GGRSVSSKSGSADVLEALGASIDLAPARVAQCMDETDIGFMFAPNHHPAMKVVAPVRKEM
GVRTLFNILGPLTNPAGAPNILMGVFHPDLVGIQVRVLQQLGARHALVVWGRDGMDEISL
GASTLVGELRDGEVREYEVEPEDFGLAMASSRNLRVENAAESRAMLLEALEGRRGVPHDI
VCLNAGAALYAADVAPSIAAGIELARATIASGAARAKMDAFVATTRRLATA