Protein Info for ABZR86_RS12040 in Dyella japonica UNC79MFTsu3.2

Annotation: adenosylmethionine decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03331: S-adenosylmethionine decarboxylase proenzyme
  • amino acids 7 to 260 (254 residues), 454.8 bits, E=3.9e-141
• PF02675: AdoMet_dc
  • amino acids 48 to 167 (120 residues), 53.3 bits, E=1.6e-18

Best Hits

Swiss-Prot: 86% identical to SPED_XANAC: S-adenosylmethionine decarboxylase proenzyme (speD) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K01611, S-adenosylmethionine decarboxylase [EC: 4.1.1.50] (inferred from 85% identity to psu:Psesu_0328)

MetaCyc: 63% identical to S-adenosylmethionine decarboxylase proenzyme (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"S-adenosylmethionine decarboxylase proenzyme (EC 4.1.1.50), prokaryotic class 1A" in subsystem Polyamine Metabolism (EC 4.1.1.50)

MetaCyc Pathways

• L-methionine salvage cycle III (11/11 steps found)
• L-methionine salvage cycle I (bacteria and plants) (10/12 steps found)
• spermidine biosynthesis I (2/2 steps found)
• superpathway of polyamine biosynthesis II (6/8 steps found)
• superpathway of arginine and polyamine biosynthesis (12/17 steps found)
• spermine biosynthesis (1/2 steps found)
• spermidine biosynthesis III (2/4 steps found)
• aminopropylcadaverine biosynthesis (1/3 steps found)
• superpathway of polyamine biosynthesis I (4/8 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Methionine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.50

Sequence Analysis Tools

See A0A1I2GWL3 at UniProt or InterPro

Protein Sequence (261 amino acids)

>ABZR86_RS12040 adenosylmethionine decarboxylase (Dyella japonica UNC79MFTsu3.2)
MVKPLPRLRLQGFNNLTKALSFNIYDICYAVSEEQRQRYIEYIDEQYDADRLTQILTDVA
EIIGANILNIARQDYDPQGASVTILISEEPVVEKLGRDTISGAVVAHMDKSHITVHTYPE
THPHNGIATFRADIDVATCGVISPLKALNYLIDSFESDIVIADYRVRGFTRDVKGKKHFI
DHKINSVQDYLAKHIRQKYEMFDVNVYQENMFHTKMHIKDFDLDTYLFEAHADDLSFKER
QRIESLLRREIEELFHGRNLM