Protein Info for ABZR86_RS12005 in Dyella japonica UNC79MFTsu3.2
Annotation: ribose-5-phosphate isomerase RpiA
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 74% identical to RPIA_XANOM: Ribose-5-phosphate isomerase A (rpiA) from Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
KEGG orthology group: K01807, ribose 5-phosphate isomerase A [EC: 5.3.1.6] (inferred from 73% identity to psu:Psesu_2645)MetaCyc: 64% identical to ribose-5-phosphate isomerase A (Escherichia coli K-12 substr. MG1655)
Ribose-5-phosphate isomerase. [EC: 5.3.1.6]
Predicted SEED Role
"Ribose 5-phosphate isomerase A (EC 5.3.1.6)" in subsystem Calvin-Benson cycle or D-ribose utilization or Pentose phosphate pathway (EC 5.3.1.6)
MetaCyc Pathways
- superpathway of glucose and xylose degradation (16/17 steps found)
- Bifidobacterium shunt (14/15 steps found)
- pentose phosphate pathway (8/8 steps found)
- pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
- formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
- Rubisco shunt (8/10 steps found)
- pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
- formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
- Calvin-Benson-Bassham cycle (9/13 steps found)
- ethene biosynthesis V (engineered) (17/25 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (17/26 steps found)
- oxygenic photosynthesis (10/17 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of plant hormones
- Carbon fixation in photosynthetic organisms
- Pentose phosphate pathway
Isozymes
No predicted isozymesUse Curated BLAST to search for 5.3.1.6
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1I2H0C6 at UniProt or InterPro
Protein Sequence (211 amino acids)
>ABZR86_RS12005 ribose-5-phosphate isomerase RpiA (Dyella japonica UNC79MFTsu3.2) MSNEKRLAGEAAIRYVEDGGIVGVGTGSTVAFFIDALADLKDRIQGAVSSSEQSTAQLKR VGIPVLDLNATGPLSIYVDGADECDPYKRLIKGGGAALTREKIIAAASARFVCIIDSSKR VELLGKFPLPIEVIPMARSLVGREIVKRGGNPVWRDGVVTDNGNWVIDVHGWQIADPVAL EKDLNQIPGIVTVGLFAQRAADVVLIGDREM