Protein Info for ABZR86_RS11910 in Dyella japonica UNC79MFTsu3.2

Annotation: radical SAM family heme chaperone HemW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 TIGR00539: putative oxygen-independent coproporphyrinogen III oxidase" amino acids 8 to 355 (348 residues), 359.6 bits, see alignment E=9.3e-112 PF04055: Radical_SAM" amino acids 11 to 180 (170 residues), 88 bits, see alignment E=8.4e-29 PF06969: HemN_C" amino acids 314 to 378 (65 residues), 48.3 bits, see alignment E=8.6e-17

Best Hits

KEGG orthology group: K02495, oxygen-independent coproporphyrinogen III oxidase [EC: 1.3.99.22] (inferred from 64% identity to smt:Smal_3273)

Predicted SEED Role

"Radical SAM family enzyme, similar to coproporphyrinogen III oxidase, oxygen-independent, clustered with nucleoside-triphosphatase RdgB" in subsystem Heat shock dnaK gene cluster extended or Heme and Siroheme Biosynthesis or Queuosine-Archaeosine Biosynthesis

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.22

Use Curated BLAST to search for 1.3.99.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2GZW2 at UniProt or InterPro

Protein Sequence (388 amino acids)

>ABZR86_RS11910 radical SAM family heme chaperone HemW (Dyella japonica UNC79MFTsu3.2)
MPLAAPPLSLYVHMPWCVKKCPYCDFNSHGLRGEPPPYERYVELLLADLDADRSDFAAAL
EGRPVRSIFFGGGTPSLFAPELIARFLDGVRERLPLAGEAEITLETNPGTVEHGRFDGYL
TAGVNRLSFGIQSFDDDKLRRLGRIHSAAEAAAAVKSAQDAGYANINLDLMYALPEQTLD
GALADVARAVALAPTHISHYQLTLEPNTAFAANPPPLPDDDHAWAMQEACEQALATAGYG
QYEISAYARPGRRCAHNLNYWQFGDYLGIGAGAHGKLSDAGAGQVRRRWKTRHPRAWMEA
AGGPGRIGGDQAVSDDELPFEYMLNALRLIDGVPMDAFEARTGLPLERIAIALDRCHQRG
WLQDDPTRLRTTALGQRFLNDVIASFLD