Protein Info for ABZR86_RS11900 in Dyella japonica UNC79MFTsu3.2

Annotation: ribonuclease PH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 transmembrane" amino acids 159 to 175 (17 residues), see Phobius details TIGR01966: ribonuclease PH" amino acids 6 to 240 (235 residues), 382.9 bits, see alignment E=2.3e-119 PF01138: RNase_PH" amino acids 14 to 144 (131 residues), 100 bits, see alignment E=1.4e-32 PF03725: RNase_PH_C" amino acids 162 to 226 (65 residues), 44 bits, see alignment E=1.7e-15

Best Hits

Swiss-Prot: 83% identical to RNPH_STRMK: Ribonuclease PH (rph) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K00989, ribonuclease PH [EC: 2.7.7.56] (inferred from 83% identity to sml:Smlt3855)

Predicted SEED Role

"Ribonuclease PH (EC 2.7.7.56)" in subsystem Heat shock dnaK gene cluster extended or tRNA processing (EC 2.7.7.56)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.56

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2H218 at UniProt or InterPro

Protein Sequence (243 amino acids)

>ABZR86_RS11900 ribonuclease PH (Dyella japonica UNC79MFTsu3.2)
MNAVSRPSGRASDQLRPVTIERHYTRHAEGSVLVSFGDTRVLCTASVEDRVPPWLRGKGE
GWVTAEYGMLPRATSSRTQREAARGGQGGRTQEIQRLIGRSLRACVDRQALGERVITLDC
DVIQADGGTRTAAITGAYVALVDAVNVLMKRENLRRNPVFGAIAAVSVGIYQGMPVLDLD
YAEDSSCDTDMNVVMNDGGGFIEVQGTAEGHAFRRDEMDSLLRLADQGIGELVAAQRAAL
AQG