Protein Info for ABZR86_RS11885 in Dyella japonica UNC79MFTsu3.2
Annotation: ATP-binding cassette domain-containing protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 54% identical to MLAF_ECO57: Intermembrane phospholipid transport system ATP-binding protein MlaF (mlaF) from Escherichia coli O157:H7
KEGG orthology group: K02065, putative ABC transport system ATP-binding protein (inferred from 60% identity to mca:MCA1969)Predicted SEED Role
"Methionine ABC transporter ATP-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1I2H0A0 at UniProt or InterPro
Protein Sequence (277 amino acids)
>ABZR86_RS11885 ATP-binding cassette domain-containing protein (Dyella japonica UNC79MFTsu3.2) MTDSVRAKPDDSAIVRVRGLTTVLNGKTIFDALDLDIPRGKVTAIMGPSGTGKTTLLKHI TGQMRGQSGEVWVDGRNVPALRREQLFELRERIGYLFQNSALLTDFDVFENVAFPLRQHT ALPEVLIRNIVLTKLQAVGLRGAARLLPSELSGGMARRVALARAIVFDPMLILYDEPFVG LDPIALNQVLKLIRTLNETLGITSVLVAHELAAVQQVADHVYLIANGKVVAQGDPKTIAS DGSPWTRQFFGGEADGPVPFQYPAGDYAASLGFKGGA