Protein Info for ABZR86_RS11880 in Dyella japonica UNC79MFTsu3.2

Annotation: lipid asymmetry maintenance ABC transporter permease subunit MlaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 44 to 67 (24 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 101 to 107 (7 residues), see Phobius details amino acids 144 to 175 (32 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 231 to 254 (24 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 10 to 254 (245 residues), 257 bits, see alignment E=1.1e-80 PF02405: MlaE" amino acids 40 to 252 (213 residues), 238 bits, see alignment E=4.4e-75

Best Hits

Swiss-Prot: 55% identical to MLAE_ECOL6: Intermembrane phospholipid transport system permease protein MlaE (mlaE) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 63% identity to tbd:Tbd_1899)

Predicted SEED Role

"Uncharacterized ABC transporter, permease component YrbE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2GYL9 at UniProt or InterPro

Protein Sequence (255 amino acids)

>ABZR86_RS11880 lipid asymmetry maintenance ABC transporter permease subunit MlaE (Dyella japonica UNC79MFTsu3.2)
MNAPRDNIVTRSLAQIGDCGLFLLQILAAVPRSMRHARETVRQLWFVGAMSLIIIMVCGL
FVGMVLGLQLYDVLSIFGGTSATGTVVAIAIYRELGPVVTALLFAGRAGTSVTAEIGLMR
ATDQIAAMEMMAVDPIAYVAVPRFLAGIIAMPLLCCVFCALGIFGGHLVGVSWLGIDNGT
FWSNMTATVDLVKDVLNGVLWKSMAFGGVVSLIAVFQGYTTPPTSEGVAYATTRTVVASS
IAILALDFVLTAFLM